CAZyme Information: ASPWEDRAFT_33441-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_33441-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		69959.27	5.0594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:301069-303030(+)

Full Sequence      

MAAYPRPDFQRPALNWTSLNGAWDFIFDDSDQGLSQRWHHEGIPQKKQQIQVPYAFQTPA
SGIGIHEAHEVLWYERVVEDIRTPDEVARGHQLLLRFGAVDYDCTVWLDGQAVGGHRGGH
VPFDLNVTDAFSGNKAGRLTLRVRDSPYDLGQPRGKQYWGPVPESIFYTPTSGIWQSVWV
ESVPKMRIGGGSEGTVLRSDDIESGQLHARFAVLGRPAGASKGEIEIEASLAGVTVSRNR
QELAQEKDWVCLDVDMRVSDAHGSLPVDNGVALWAPEHPTLYDLTLRLYNEEGQLLDEVQ
TTTGMRNISWTVGDSTFRINGKPRFQTLVLDQGYWPETGLTPPSQEALRLDIELCQKMGV
NGCRKHQKVEDPVFYYWADRLGFLVWGEMANAYEFSDDYISRFNSEWVEAVKRDINHPSI
VTWTPFNESWAYPALGSNVEQRNHIRAIYYLTKTLDPTRPINDNCGWEHVVTDLTTYHDY
TDAPALAATCSDFNTGILGQKGGHDMFVGPTKSDPGTKHAPGAPVICSEMGGVNIIPTKG
TAGERDWGYTTATDPEDFLGRLERLVMAVVKGGHSCGLVYTQLCDIEQEVNGLYSYDRQE
KVAAARVKGIMDAAHQYYYEHVMPK

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_33441-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	487	3.4e-102	0.5079787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.55e-36	17	462	13	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	4.76e-32	18	461	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	2.32e-24	8	477	32	490	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	4.54e-15	172	461	207	485	beta-galactosidase.
397119	Glyco_hydro_2_C	1.39e-14	312	510	3	218	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91609.1|GH2	0.0	1	625	1	649
QMW47280.1|GH2	0.0	1	625	1	649
QMW35218.1|GH2	0.0	1	625	1	649
UDD64307.1|GH2	0.0	1	625	1	641
CAK44902.1|GH2	0.0	1	625	1	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.67e-62	4	599	29	566	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	2.04e-20	9	428	19	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	4.73e-20	18	428	37	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5C70_A	2.99e-19	10	461	14	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
6D8G_A	5.81e-19	18	428	37	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	7.64e-20	4	461	29	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P77989|BGAL_THEP3	9.00e-20	19	480	19	433	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|Q2XQU3|BGAL2_ENTCL	1.17e-19	18	474	55	500	Beta-galactosidase 2 OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
sp|Q47077|BGAL1_ENTCL	1.54e-19	18	474	55	500	Beta-galactosidase OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
sp|T2KPJ7|PLH8_FORAG	2.30e-19	95	459	124	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_33441-t33_1-p1.