CAZyme Information: ASPWEDRAFT_27371-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_27371-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	KV878212|CGC27	91156.05	7.9466

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:121786-124571(-)

Full Sequence      

MDSSTKSGLHDRDSLDVLAPPPYSPYADGGLATESADVQANGRIDVDLDSGIARTLARII
DLQQEDQQNPPPEYWQEPAKVEFDIQLNIVIQIVGSRGDVQPFIALGNELQKYGHRIRIA
THDVFADFVMESGLEFYPIGGDPKELMAFMVKNPGLIPQMKSLRAGEVQKKRAMMAEILN
GCWKSCIEDDPITKAPFVADAIIANPPSFAHIHCAQALSVPVHLMFTMPWTSTRAFPHPL
ANLRPSNMNRPLANLVSYGVVEWLTWQGLGDVINKWRSSIDLEPISAIEGATLAETLKVP
FTYCWSPALVPKPEDWPGHVDVCGFFFREAPSYTPPVELQRFLDSGPPPVYIGFGSIVIE
DPQALTNTILHAVSQTGVRAIISRGWSKLGGSQNDNIYYIDDCPHEWLFQHVAAVVHHGG
AGTTACGLLNGRPTTIVPFFGDQPFWGDMVARAGAGARPIPYASLNATNLADAIGLGLTP
EAQKAAYGISLKMKSESGMRTAVQSFHRNLPLDRMRCSLLPNQAAVWKYTKTKNNLRLSK
AAVQILINHDKVDAKHLRPHDIKRIVIENRRWDPVTGILSAATNTGTDMLKSTTDMFYKP
YKEYNRGRSPRITGSSSDRSMSLPVRPATADPTALPHANTDPANADPVGIVDSERRNGWL
TAGSMMGASLKGLGKFTGTYFRGVVVDIPHAAAEGFRQVPRLYGDQPKEYEPVRNWKTGA
TVGGKNFVDGMTDGFRGLFTQPIEGARDEGALGAVKGFAKGTIGLATKVPSAGLGLVAYP
FHGIAKSIESAVRSKTRKIIVNARLRDGYNLTRMQVTEEEQQYILQRFNTLI

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	186	507	2.4e-51	0.7722513089005235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.47e-81	87	508	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.52e-48	89	508	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.29e-25	89	237	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	2.97e-09	673	769	2305	2394	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	5.14e-06	98	474	7	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15859.1|GT1	0.0	19	831	20	840
BCS04269.1|GT1	0.0	19	831	20	840
CAK48301.1|GT1	0.0	1	831	1	840
CAP79869.1|GT1	0.0	1	829	1	838
BCS26658.1|GT1	0.0	15	832	20	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.31e-78	94	514	27	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.23e-78	94	514	47	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	8.06e-30	87	496	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.23e-29	87	486	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.70e-24	87	490	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	3.66e-129	87	518	193	618	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	3.44e-126	66	511	120	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	2.72e-79	87	511	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q4WID6|ATG26_ASPFU	6.32e-78	87	510	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|Q6C8M8|ATG26_YARLI	9.77e-78	78	514	986	1417	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_27371-t33_1-p1.