CAZyme Information: ASPWEDRAFT_27147-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_27147-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	KV878211|CGC10	65795.34	5.9016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:3864692-3866585(-)

Full Sequence      

MAQTNSIEEFLRTPFDFLICGGGTAGCAIAARLTENPGINVGVIEAGKWRAGDELVDTPG
AFSQMFENPDYDWCLYTAPQQANHGRIHHIPRGKLLGGSSGINYMMYVRGSLQDYNDWAA
LVGDEGWSAKVMQHYMRKHQTLEPIAAGVEKGATPLVGEFHGTSGPVRTGFNEMNLPIEE
DIIQACKELAGISKDVVDPWSGDHIGFFRTLGSVARSGPARGKRSYAARGYYEANRQRPN
LKVLCEAQVNRVILDGNKATGVNVTVDGKEYNIPTREEVIVCAGAVKSPQILELSGIGDP
DVLAAAGVACVVENRAVGANLQDHSLTLLGYDVQPGVLTLDTLHQQPEAMQAAIKEYAEN
GSGPLSSIASMQGFFPAKSIMSETELAAVIRSIEETKPADAFHQKQLAQVIQHLKSGDSG
NLQLVLVPASANLPGGVEHQSVLWPPRPADQPAGVALALCLEYPVSRGYVHINSADPSRP
PVIQPNYAAHEADVAVLAAFLRWADKIGSSKHVQHSIARRSYPDPASNLQDFDSAKQAVH
DVVVGEYHVCGSVAMGAALDSRLRVKGVEGLRVADASVFPNNVSGNIVSSVYAVAEKAAD
LIKEDFVSLSSHKL

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_27147-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	605	2.1e-166	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.94e-103	15	605	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.91e-103	15	603	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.87e-35	464	598	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.01e-32	85	324	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.92e-21	15	579	56	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ78676.1|AA3_2	9.33e-303	1	606	11	616
BCS21673.1|AA3_2	3.10e-299	2	606	11	615
QQK46529.1|AA3_2	9.70e-296	4	606	6	609
UKZ52878.1|AA3	1.03e-272	1	606	11	594
UJO22487.1|AA3_2	1.14e-238	3	606	16	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.02e-62	15	605	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.06e-61	15	605	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	7.56e-59	15	606	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS2_AAA	4.60e-57	15	602	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	8.77e-57	15	602	84	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.96e-151	4	605	3	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.96e-151	4	605	3	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.82e-143	6	605	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.35e-77	8	605	33	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P64264|Y1310_MYCBO	2.90e-70	13	603	3	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000016

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_27147-t33_1-p1.