CAZyme Information: ASPWEDRAFT_23552-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_23552-t33_1-p1
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	KV878209|CGC12	85423.25	4.5798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:3832206-3835082(-)

Full Sequence      

MIPSLLSKGLLLLQLFSLAAGKNASDSSTPRYKDASAPVEERVTDLLGRMTTEDKMAQLI
QGDITNWMDGTTGDFNYTGLVENMETKAGMFYVGYPVSWDWIATNVKKAQDYLLENTKLG
IPALVQTESIHGFLIGNATIFNSPIGYGCSFNKELVEKMAKIIGQEALALGVNQLFAPVV
DLARELRFGRVEETFSEDPYLAGEIGYYYTKGLQSTNVSATVKHFAGFSKPEQGLNTGPV
HGGERELRTTWLPPFKRAIIDAGAWNIMSAYHSYDGIPAISDYHTLTEILREEWGYDYWV
ISDAGATDRLCTAFRLCRSSPIDMEAITLQALPAGNDVEMGGGSFNFQKIAELVESGKLD
VEVVNTAVKRVLRAKFEMGIFENPYPAAPKSDWNKLIHSSEAIELARELDKESIVLLENH
NNTLPLKKSGNIAVIGPMAHGFMNYGDYVVYESQYRGVTPLDGIKAAVGNEAQVHYAQGC
ERWSNDQSGFSEAIDAAKKSDVAVVVVGTWSRDQMELWQGMNATTGEHVDVNSLSLVGAQ
GPLVKAIADTGVPTVVVLSSGKPISDVWISNSTSALIQQFYPSEQGGNALADVLFGDYNP
SGKLSVSFPRSVGDLPIYYDYPNSGRDITDSGYIETDGTLVFGHQYVLGNPNPWYPFGYG
KSYSTFEYGSVSLDKANVSASDTVTISVDVTNTHTEREGTEVVQVYIVDEVSSVVIPNRR
LRGFEKIVIPAGKTKTVEISLQVEDLGLWNASMKYVVEPGAFMALVGSSSADIRGNATFY
VQ

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	340	7.5e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.58e-164	19	779	20	762	beta-glucosidase BglX.
224389	BglX	8.34e-84	50	481	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.70e-68	118	767	78	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.38e-62	39	374	2	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	3.57e-61	414	663	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW32562.1|GH3	0.0	1	782	1	779
QMW44592.1|GH3	0.0	1	782	1	779
BAE62006.1|GH3|3.2.1.120	0.0	1	782	1	779
UDD57574.1|GH3	0.0	1	782	1	779
CAP98759.1|GH3	0.0	1	782	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	30	782	5	757	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	30	782	5	757	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.07e-121	18	774	26	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	9.07e-114	34	774	2	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	3.13e-113	46	774	17	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	1.80e-126	116	770	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	8.42e-125	29	774	30	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.68e-122	29	774	30	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	2.56e-100	32	774	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	1.05e-96	118	773	34	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999770	CS pos: 21-22. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_23552-t33_1-p1.