CAZyme Information: ASPWEDRAFT_189665-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_189665-t33_1-p1
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	KV878209|CGC5	97860.09	8.3495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:131951-134907(+)

Full Sequence      

MNNTRRLAAYDSDGEEQEESLLHRGQAGPFDGPFDDPTSDPQRRYSLRDPGGGSIFPGAT
LGAESQIERPVSSAGSINSDAWQKRQKPAPGMLRRYTTRKIKLVQGSVLSVDYPVPSAIQ
NAIQPEYREAEEGFSEEFTHMRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAITYYN
EDKVLTARTLHGVMQNIRDIVNLKKSEFWNKGGPAWQKIAVCLVFDGIDPCDKNTLDLLA
TVGVYQDGIMKKSVDGTETVAHIFEYTTQLSVTPNQQLIRPHDGETTNLPPVQMMFCLKQ
KNSKKINSHRWLFNAFCRILNPEVVILLDAGTKPGKKSLLALWEAFYNDRNLGGACGEIH
AMLGKGWRNLVNPLVAAQNFEYKISNILDKPLESSFGYVSVLPGAFSAYRYRAIMGRPLE
QYFHGDHTLSKKLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHLTYVKASKGET
DVPEGTAEFISQRRRWLNGSFAATLYSIMHFGRIYRSGHNIIRLFFLHIQLLYNSFQLLM
TWFSLSSYWLTSSVIMDLVGTPAESNQNKGWPFGNEATPIVNTFVKYGYVFFLMLQFILA
LGNRPKGAKFFYTLSFLYFSLVQFYILILSFYLVVGAFTGGMMDFNFNQGFGSFVSSFFS
SSGGGVVLIALVSTYGIYVVASILYADPWHILTSSWAYFLGMTTSINILMVYAFCNWHDV
SWGTKGSDKAEALPAAETKKDDATSNFIEEFDKPQADIDSQFESTVKRALAPFVEPVENE
SKNLDDSYRSFRTNLVLLWIFSNLLLTLLITSENVKKFCLTNTSTTRTSYFFEVILWSTA
ALSLFRFIGALWFLGKSGILCCFSRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	178	346	5.7e-71	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.66e-99	178	346	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.04e-90	174	503	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	9.73e-34	100	177	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	5.72e-26	295	642	115	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.68e-17	294	415	55	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82630.1|GT2	0.0	16	866	38	897
CAK41385.1|GT2	0.0	15	866	33	884
BCS03083.1|GT2	0.0	15	866	41	892
BCS14730.1|GT2	0.0	15	866	41	892
CAP97313.1|GT2	0.0	16	866	51	908

PDB Hits     

ASPWEDRAFT_189665-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	13	866	36	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	78	822	115	864	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	51	866	91	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	52	866	98	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	50	866	85	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

Start	End
521	543
580	602
614	636
663	685
692	714
795	812
832	854