CAZyme Information: ASPWEDRAFT_184171-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_184171-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		43075.16	6.7386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:4041991-4043273(-)

Full Sequence      

MKAFQTAVAAAAIFGTTAYAIDIKINDQESIKHAAASAAFNTMGNYTGNETGQIPGAFPT
KWWEGAALFESMITYWHYTKDASNNAAVRQGMNWQRGDNNDFMPANYSAYIGNDDQLAWG
SAALTAAELNFLQDKGVPTWLEMAENVFNDEIKRWDPRTCGGGLRWQIFPYQAGYAQKNA
ATNGKLFQLAARLAHFTGNETYVDVANQAWDWSIKSHLLNTETWSVVDTINSGKNCSLSG
DVWSRNYGPYMSGAAVMYNVTNGDQKWKTGLVGLVNSTISTFFPSKYGGNILSEVNCEAK
NNCDSNQKALKGMLALDLAATVRAAPLTVFRIWPKLQGSAVAAAKQCTGGNTHTVCGGRW
YEPKWDGSDAFEDQLAATNIFVANLAVPKPGSGRH

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_184171-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	28	386	5.6e-85	0.9301675977653632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.23e-143	30	377	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44952.1|GH76	8.89e-154	4	389	6	391
BCS13375.1|GH76	1.92e-150	11	389	14	392
BCS01664.1|GH76	1.92e-150	11	389	14	392
BCR95806.1|GH76	1.20e-142	14	393	18	397
BCS08339.1|GH76	1.20e-142	14	393	18	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.39e-62	24	388	29	409	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.69e-80	20	390	21	390	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	2.77e-80	58	386	52	380	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	1.49e-77	19	389	17	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	1.48e-76	11	385	10	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5ACZ2|DFG5_CANAL	4.51e-74	13	388	14	392	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999683	CS pos: 20-21. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_184171-t33_1-p1.