CAZyme Information: ASPWEDRAFT_182797-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_182797-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	KV878212|CGC5	26877.59	6.7658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:27903-28751(+)

Full Sequence      

MNYFLSILVGALLLCIDSFALPTAQPESDSRLPDASHVLLRTMPLGASITYGTKSTDGNG
FRKAFHEKLREAGHPVDMVGSRKAGTMKDNDNEGWPGFTVDQVHKKASANFGPKPNLYLI
EAGTNDCVKEVDVAHARERMENMINDIFTHVPSTTIILSGLLPLKKNDTCAQEISAGYKE
LVGQLQEKKKKIVFADMHNGQIKLSDLVDGTHPTDAGYKTMAEIWFSAFQDAAHRNFLTA
PLSNS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_182797-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	40	228	1.8e-57	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.11e-44	40	229	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.59e-18	45	228	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.53e-16	43	225	2	224	GDSL-like Lipase/Acylhydrolase.
404371	Lipase_GDSL_2	8.69e-16	45	219	2	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238879	NnaC_like	2.67e-09	108	224	45	169	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23779.1|CE3	1.32e-66	40	238	44	241
UQC79481.1|CE0	6.09e-63	22	241	30	253
BAE62547.1|CE3	7.84e-60	11	241	19	258
QPG99528.1|CE3	2.72e-57	24	243	29	253
UDD56943.1|CE0	3.13e-55	11	241	19	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	3.73e-15	40	226	6	192	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

ASPWEDRAFT_182797-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999704	CS pos: 20-21. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_182797-t33_1-p1.