CAZyme Information: ASPWEDRAFT_177439-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_177439-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	KV878218|CGC3	50158.35	4.3489

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:107734-109241(+)

Full Sequence      

MRLDWRQLCGAAALLLQGQVALADLGIQANDADSLKKAGKTITEPMIEFYHANETEGIPG
KLTDTWYIAGSMFMTYLQYWDASGDDTYNSLVSHDLMFQAGDNYDYFPANWSQWLGNDDQ
MFWGLAAMTAAETGFPEVDGKPSWSSMARAVFEMQAGKWDTGTCNGGLHWQCWPIQAGYT
MKNSISNGGLFFLAARLARFTKNETYVEWAETIWDWSVDSPLVNNNTWHIADSTNTENNC
QDSGDNQWTYNYGTYLGGAVFLANYTNGGEKWTTRANGILDVAMKQFFPQKYGSGEVLSE
VACDPIMTCDRNQLGFKGYMSMWLAFTALLMPETYDKIAPKLQTTALAVSKQCSGESKSL
CGEQWWNPTWDGMQGLEVQMAALGAVTANLMVMAHQSPKTVDTNPDGGADAIDTGDDGRQ
KKSRITTGDRAGAWVLTVIMIVFIAGGMGWLVKS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_177439-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	398	1e-95	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.36e-168	34	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	3.71e-231	3	454	4	457
QRD92720.1|GH76	3.71e-231	3	454	4	457
QMW36289.1|GH76	3.71e-231	3	454	4	457
UDD65548.1|GH76	3.71e-231	3	454	4	457
BAE66452.1|GH76	5.27e-231	3	454	4	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.97e-82	33	403	34	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.77e-93	27	452	24	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.98e-92	15	452	6	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	7.63e-88	25	396	20	390	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	5.66e-87	27	452	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	8.58e-86	13	452	10	450	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000620	0.999361	CS pos: 23-24. Pr: 0.9749

TMHMM  Annotations     

Start	End
430	452