CAZyme Information: ASPWEDRAFT_171376-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_171376-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	KV878211|CGC12	37503.14	4.2971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:4138828-4139976(-)

Full Sequence      

MHSFQLLGLAALGSLAAAAPHATPVDKRASSCTFTDAAKASESISSCSSVVLKDIEVPAG
ETLDLSDAADGATITFEGTTSFGYKEWKGPLIRLAGKGVTITGADGHVIDGDGSRWWDTK
GTNGGKTKPKFMYAHKLEDSTIKGLSIKNTPVQAISVQATNLHLNDITIDNSDGDDNGGH
NTDGFDISESTGIYINGATVKNQDDCIAINSGENIEFTGGKCSGGHGLSIGSIGGRDNNT
VKNVTISSSSVTDSANGIRIKTIVDETGSVSDVTYSDITLSGITDYGIVFEQDYKNGGPT
GEPSTGIPITDVTVDGVTGSVEDDATPIYILCGSGSCSDWTFTGVDITGGEKSSKCSNVP
SGASC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	45	360	5.6e-75	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.77e-141	50	365	4	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	7.93e-25	98	364	140	394	polygalacturonase
177865	PLN02218	1.89e-22	99	359	158	420	polygalacturonase ADPG
227721	Pgu1	1.66e-21	69	289	174	405	Polygalacturonase [Carbohydrate transport and metabolism].
178580	PLN03003	8.05e-20	97	297	113	304	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA41693.1|GH28|3.2.1.15	1.94e-202	1	365	1	368
CAK44054.1|GH28|3.2.1.15	1.94e-202	1	365	1	368
BCS06061.1|GH28	7.51e-200	1	365	1	368
BCR93418.1|GH28	7.51e-200	1	365	1	368
CAE46194.1|GH28|3.2.1.15	7.43e-191	1	365	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NHC_A	1.90e-193	30	365	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	6.62e-156	23	365	3	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.80e-155	23	365	3	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	7.74e-153	31	365	2	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	1.78e-147	31	363	2	335	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QAH3|PGLR1_ASPNC	3.45e-203	1	365	1	368	Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaI PE=3 SV=1
sp|P26213|PGLR1_ASPNG	3.45e-203	1	365	1	368	Endopolygalacturonase I OS=Aspergillus niger OX=5061 GN=pgaI PE=1 SV=1
sp|B0Y4Z4|PGLRA_ASPFC	3.46e-196	1	365	1	368	Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaA PE=3 SV=1
sp|Q4WQT2|PGLRA_ASPFU	3.46e-196	1	365	1	368	Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgaA PE=3 SV=1
sp|Q0CMU3|PGLR1_ASPTN	3.46e-196	1	365	1	368	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999738	CS pos: 28-29. Pr: 0.8209

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_171376-t33_1-p1.