CAZyme Information: ASPWEDRAFT_170444-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_170444-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		62081.80	5.1092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:1768257-1770061(+)

Full Sequence      

MSHFDFIVVGSGPSGSAIAAGLANAAQRPSVLLLEAGSKNEDRSLRVDGKRWLTFQNQDM
NWGYKTTPQEDCNNREIDYSRGRCVGGSSAINFGVYSVGARDDYEEWARIAGDDSYKWTN
IQARLKALETFHGEIPAGLDAKYAAPKAEDHGSSGPLHVGFSKEWERDLPPLLDVFEEAG
FPLNPDHNSGNPIGMSVLINSSFKGLRSTAADLVAAPLDNLTIVADAPVQRIILEGKKAV
GVESNGKQYLASKEVILSAGSLNDPRILMHSGIGPADQLEKFNIPLVHSSPAIGQGLRDH
CFCPLVTTRNEGSNDRKAFYGDKQAMETALKQWEEEGSGPWSKFACELGIGWFKLDKLTA
SQEFKDLPADEQKYLLQETVPHYEILTHFPVHWFIPDFPDDALNYSCLLVFFFNAQTRGE
VTLQSADPNAPLRFDPKFLAHPYDRRAAIEALRDSFRIAKHESYTKDNVAQLAGPKSDSD
EDLLEYWRQNISSSWHMTGTVKMGKVGDADAAVDPDFRLIGIENLRVADMAAVPVLVNCH
VQAVAYVTGATCAEKLIKEYKLN

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_170444-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	558	3.2e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.54e-83	1	559	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.29e-76	1	538	3	513	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.37e-36	416	552	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.01e-27	72	300	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.93e-26	4	529	56	549	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK45569.1|AA3_2	0.0	1	562	1	563
QMW45359.1|AA3_2	0.0	2	562	3	563
QMW33321.1|AA3_2	0.0	2	562	3	563
UDD61192.1|AA3_2	0.0	2	562	3	563
QRD84914.1|AA3_2	0.0	2	559	3	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	3.63e-58	2	558	1	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	4.94e-58	4	558	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3Q9T_A	2.21e-55	2	561	5	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.06e-55	2	561	5	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.23e-55	2	561	5	574	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	5.65e-57	4	563	52	627	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.86e-57	4	559	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A6U6Y8|BETA_SINMW	2.57e-56	5	562	4	531	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	6.56e-56	4	560	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q2KB43|BETA_RHIEC	6.87e-56	5	562	4	531	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_170444-t33_1-p1.