CAZyme Information: ASPWEDRAFT_169761-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_169761-t33_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497		53234.43	5.8963

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:4951294-4952908(-)

Full Sequence      

MLLKSLIAANAFAGAAVASPAPMLQARQDDLATYIQNEHTYALQGVLNNFGPNGNLSRGA
APGVAIAGNSETNPPYIYTWTRDTALTVQSLIHEFISGNTSLEPLIQQYVNASARMQTIP
NLSGNLTDGSGLGEPKYNINITAFNEPWGRPQPDGPALRASALIAYGNHLLGQGQQAKAL
SHIWPIVSNDIAYVGQYWNSTGFDLWEEVNGTSFFTTAVQHKALVEGQAFATALGKPCEA
CTVAPEILCHLQNFWNGTAVIANTPTSYDNSRSGVDINSVLTSINTFDPAATCDDVTFQP
CSARALANHKVLVDGFRSIYGVNRNRSSSSAVAVGRYTEDVFMGGNPWYLATLAAAEQLY
DALYQWNRQGSLEVTQLSLPFFKSLNANVTTGIFPKSSPSYTVITNAVKTYADGFVAVVQ
QYTPGNGGLSEEYNRDTGVQVSSPDLTWSFASFLTATARRNGSVPPSWGSSRALAVPSQC
RPATVKGTYAAATPSPW

Enzyme Prediction     

EC	3.2.1.3:94

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	53	457	2.1e-67	0.9667590027700831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	4.72e-124	42	456	3	415	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	1.34e-06	69	454	285	607	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225922	SGA1	1.01e-05	60	467	266	612	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82776.1|GH15	6.17e-264	1	495	1	493
QMW39855.1|GH15	5.02e-225	6	497	6	493
QRD82209.1|GH15	5.02e-225	6	497	6	493
QMW27784.1|GH15	5.02e-225	6	497	6	493
UDD55716.1|GH15	5.02e-225	6	497	6	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQA_A	3.96e-188	31	497	3	466	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
6FRV_A	5.72e-186	31	497	3	466	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
6FHV_A	7.83e-186	30	493	7	476	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
1AGM_A	1.22e-184	31	497	3	465	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	1.26e-184	31	497	3	465	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P69328|AMYG_ASPNG	6.47e-185	31	497	27	490	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P69327|AMYG_ASPAW	6.47e-185	31	497	27	490	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P22832|AMYG_ASPUS	7.55e-181	1	497	1	489	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P14804|AMYG_NEUCR	5.65e-180	2	493	3	497	Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gla-1 PE=1 SV=3
sp|P23176|AMYG_ASPKA	9.86e-179	31	497	27	489	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999572	CS pos: 27-28. Pr: 0.8216

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_169761-t33_1-p1.