CAZyme Information: ASPWEDRAFT_168321-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_168321-t33_1-p1
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820		92895.98	4.7302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:945243-948078(-)

Full Sequence      

MYRLNISILLASLLYTVGIIASQGSAADVAGLTKEAARANNESLLWGPYKPNLYFGVRPR
IANSLFSGLLWAKVDDFATAQQNFRHTCEQNEGMAGYGWDEYDIRKGGRQTIHDAENSLD
LTIDFIKVPGGQQGGNWGARIKGVPREGASEDQPTSLVFYTALEGLGNLEVTTESEALGF
DGDVKLAGFTPDLGDFSIDVTAGPESNEHPEHDHPSYQDKPLHRTLVSSSTIPAEHLWQT
KVILFSQMKNEVSECIQKYGAENPPPPSQVFTIKHIPGEGNIHMVQKVFKGAFEFDVIFS
SGSSPQPLTSETLTKEITTTSMSFSNRFDNILAPKAPFNNAEYSKFSKAMLSNLVGGIGF
FHGDDIVDRSAAPEYDEENEGFWEETAEARARAQPVLEGPKDLFTSVPSRPFFPRGFLWD
EGFHLIPIVDWDIDLALEIVKSWFNLMDEDGWIAREQILGSEARSKVPPEFTIQYPHYAN
PPTLFLILEAFMDKVKANQAASLDQYSDQDIAQNVGSIYVQHPELGDAFIRSFYPLLKKH
YFWYRNTQGGDIKSYDREAFSTREAYRWRGRSVQHILTSGLDDYPRAQPPHPGELHVDLI
SWMGMMTRSLRRIAENLGEVEDVEEFKVYETAIERNIDDLHWDEQAQTYCDATIDEYEES
VHVCHKGYISIMPFLTGMVGPNHPHLKPILDLISDPEELWSDYGIRSLSKKDEFYGTAEN
YWRSPVWININYMVVKNLYDTATTSGPHQDQAREIYSRLRKNLVENVFKEWKETGFAWEQ
YNPETGKGQRTQHFTGWTSMVVKMMSMPDLANEKKGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	594	806	4.2e-34	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	308	807	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.22e-125	44	266	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	3.04e-08	453	759	304	565	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84190.1|GH63	0.0	28	820	24	817
UDD57712.1|GH63	0.0	28	820	24	817
QMW44709.1|GH63	0.0	28	820	24	829
QMW32679.1|GH63	0.0	28	820	24	829
BCR88942.1|GH63	0.0	1	820	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	5.27e-173	34	805	5	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.90e-133	44	806	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	8.20e-241	34	806	32	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	5.19e-172	34	805	35	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.61e-134	44	806	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.50e-127	46	806	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.18e-127	44	806	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004600	0.995365	CS pos: 26-27. Pr: 0.8727

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_168321-t33_1-p1.