CAZyme Information: ASPWEDRAFT_166330-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_166330-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	KV878209|CGC11	49978.34	4.0598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:660077-661683(-)

Full Sequence      

MFNLGDWSSWRNWLLLLLVSPLVQAIDLDINDDQSLKDAASTAAFGMMSHYHGNESGQTP
GKLPNTWWEGGVMFMTLIEYWYATGDTTYNDEVSVGMEWQAGDGDYMPANDSSYLGNDDQ
VFWGLAAMTAAELAYPDVDGQYSWLSLAQGVFNTQIRRWDADTCNGGLRWQIWVYEAGYT
MKNSVSNGGLFQLSARLARYTNNQTYYDWANKVWNWVESSPLLSNSTWNVADSTTVDDNC
VSQGNEQWSYNYGMFLGGAAYMYDHSNGTTKTKWLNAVNGLLNVTLDKFFPSSYGGNIMS
EITCEPNEVCNNNEILFKGLVSNWLALTSLLVPSTSDTILPKLQGSAEAAAEACTGNSNN
TCGVRWYTKKWDGWSGLEEQCSTTSVFAANLMAKNGTGPVTSTTGGNSSSDPSAGTGSKD
DGGTTAQKTITTADKAGAGILTAVFAGAWIGMMAWMLC

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_166330-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	398	1.9e-99	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.20e-173	35	382	1	346	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86001.1|GH76	2.09e-246	6	456	7	459
CAK47058.1|GH76	5.43e-229	11	457	4	454
BCS03764.1|GH76	2.12e-228	8	457	4	453
BCS15380.1|GH76	2.12e-228	8	457	4	453
BAE55608.1|GH76	6.42e-226	23	453	24	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.98e-86	30	415	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.84e-109	17	456	13	447	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	4.67e-104	15	456	3	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.51e-102	13	457	6	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	1.93e-101	15	457	11	450	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	7.69e-101	15	457	11	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999706	CS pos: 25-26. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_166330-t33_1-p1.