CAZyme Information: ASPWEDRAFT_164174-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_164174-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48370.18	6.1320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878217:375988-377307(-)

Full Sequence      

MRLQLLLQRVLKQPAARVLLASVFLYLLAFQYCRLRFWRDPHSAFFDSRTVYDWKYSLFR
EHQAKHFISIYNAPSDPPPVTVGESHPLLCAAVTTVKRDTDDYFDAAVGSLLEDLDPRER
RALHLNVLFADTDPSRHPSWEQRWVGRLADSAGSYNVSDETMEHLKELEGKRNFYEKGVF
DYNYMLEDCLATNAPYIAIFEDDIILADGWLIKTLNGLTEITRKSPQNADWLYLRLFYTE
TSLSWTSSDFWYRNMPLAFALVITAGLAALLTIRRYHPGARASYLDYPSIAVICFITLPA
FTGLVYMMGKYNIQPLQGVVEMNAYGCCTQGLVFPREQVPGLMAYLHKRGAGQTDSMIEE
YAGETGLTRYALAPQQMQHVGLRSSRDNTALNTQSTWAFWFEESDPAVLAKEHEKLLKEG
SLV

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_164174-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT109	15	418	2e-151	0.975669099756691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409190	PGAP4-like_fungal	0.0	15	388	1	375	uncharacterized fungal proteins similar to Post-GPI attachment to proteins factor 4. This subfamily contains uncharacterized fungal proteins with similarity to animal post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. Proteins from this subfamily contain the putative catalytic site of PGAP4 and may have similar activities.
409189	PGAP4-like	6.45e-44	17	385	1	361	Post-GPI attachment to proteins factor 4 and similar proteins. This family includes post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. This family also includes uncharacterized fungal proteins with similarity to PGAP4.
409191	PGAP4	2.93e-19	18	385	1	376	Post-GPI attachment to proteins factor 4. Post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246), has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases (GTs), it contains three transmembrane domains. Structural modeling suggests that PGAP4 adopts a GT-A fold split by an insertion of tandem transmembrane domains.
225843	COG3306	3.90e-05	185	276	78	169	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
133474	Glyco_transf_25	0.001	185	210	74	99	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46547.1|GT109	1.68e-178	15	419	25	428
BCR99311.1|GT109	6.02e-174	15	422	25	431
BCS11615.1|GT109	6.02e-174	15	422	25	431
QGA19659.1|GT109	1.05e-173	3	419	12	426
CAP99360.1|GT109	9.29e-149	101	417	11	327

PDB Hits     

ASPWEDRAFT_164174-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPWEDRAFT_164174-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000002

TMHMM  Annotations     

Start	End
15	32
250	272
287	309