CAZyme Information: ASPWEDRAFT_160822-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_160822-t33_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		60556.96	6.7134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878215:438030-439725(+)

Full Sequence      

MAPVTTTNEFPASDVNNYDYVIVGGGTAGCVIASRLAEYLPNKRILVIEGGPSDFMDDRV
LNLREWLNLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRW
EALGCQGWSFETFTRVLDNLRNTVQPVHSRHRNQLCKDWIESCSTAMDIPIIPDFNKEIR
SKGELTEGVGFFSVSYNPDDGRRSSASVAYIHPILRGEEKRPNLTILTNAWVSRVNVEGD
AVTGVDVKLQSGVQHTLRAKKETILCAGAVDTPRLMMLSGLGPREQLSSLGINVVKDLPG
VGENLIDHPESIILWELNYPVPPNQTTMDSDAGIFLRRELPNAAGSDGRAADVMMHCYQI
PFCLNTTRLGYDEPKDAFCMTPNIPRPRSRGRLYLTSADPSVKPALDFRYFTDPEGYDAA
TIVAGFKAARQIAQKAPFKDWIKREVAPGPKVQTDKELSEYGRRVAHTVYHPAGTTKMGD
VKRDPMAVVDPQLKIRGLKNVRIADAGVFPEMPSINPMLTVLSIGERAAELIAEEAGWKR
EQPRL

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_160822-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	541	5.2e-92	0.5194174757281553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.50e-118	16	537	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.95e-112	18	532	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.79e-43	387	528	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.79e-33	3	525	41	569	Protein HOTHEAD
366272	GMC_oxred_N	7.51e-27	18	310	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36122.1|AA3_2	0.0	4	545	1	542
QRD92907.1|AA3_2	0.0	4	545	1	542
QMW48182.1|AA3_2	0.0	4	545	1	542
BAE65509.1|AA3_2	0.0	4	545	1	542
UDD65348.1|AA3_2	0.0	4	545	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	3.56e-125	18	532	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	5.03e-125	18	532	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.42e-124	18	532	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4HA6_A	2.92e-56	17	529	1	501	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
6YS2_AAA	4.20e-56	18	536	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.83e-124	18	532	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	3.69e-79	17	533	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	5.29e-73	18	532	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.44e-73	18	535	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	6.66e-73	13	532	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000021

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_160822-t33_1-p1.