CAZyme Information: ASPWEDRAFT_140426-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_140426-t33_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		59432.98	5.3566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878215:2237343-2239013(-)

Full Sequence      

MSADYVIVGGGTAGLVVANRLSEDENTSVIVLEAGDDRTEDNQVQNPICWPSLIGSVLDW
EFKTVPQTGLNNREQEHPAGKVLGGSSTINGLVYIPPSPAGIDAWARLGNDKWNWNALLP
YLQRSYRLRAPDEIKKEFNLDAHNTGRGPISVSYPSLADERNHPLINAWNDTFKEQGYEF
TGNFLPEKTVGTRPYTATTHDRWGLGDCRSASDTEYGRNAFIRPNLDVRTGVTVRRVLFS
SASGEAIATGVEVYTRQGLVTIKAKEEVILAAGAFNTPKILELSGIGDGRLLSKLGIPTI
IDNPGVGENLQNHLMSFLPVPVKRFTELDNAPPGIKALGFVNLDQREQADLLSRFSPQSK
HDEVIRSIIQNPDEASATALLSLCETSEHAAIVVLFPSFPISRGSTHVSSQDAYVKPTID
PRFLSKRIDLEIMARLVQNLHQVPASPAFEEFFEYTNPGLDLDAIKESIHERAISTHHVC
GTAAMLPKEDGGVVDQNLRVYGTGNLRIADASIFPLIPSANPMSTVYAVAERAADLIRYR
HF

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_140426-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	538	1.8e-152	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.00e-106	1	540	4	534	choline dehydrogenase; Validated
225186	BetA	5.55e-100	1	541	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.62e-37	400	533	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.36e-27	71	314	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.26e-20	4	526	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96464.1|AA3_2	6.57e-181	1	540	4	529
BCS25452.1|AA3_2	2.65e-179	2	538	8	526
BCS12736.1|AA3_2	2.20e-177	2	541	8	532
QRD83786.1|AA3_2	4.46e-152	3	538	4	530
QMW32332.1|AA3_2	4.46e-152	3	538	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.49e-78	4	538	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.32e-69	4	538	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.96e-68	4	538	4	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.96e-63	5	541	8	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5ZU3_A	2.04e-61	4	541	8	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	1.35e-90	2	537	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.35e-90	2	537	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.64e-77	4	541	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.39e-72	2	538	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.00e-70	4	538	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_140426-t33_1-p1.