CAZyme Information: ASPWEDRAFT_137401-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_137401-t33_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	KV878214|CGC18	59524.07	5.5523

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:703523-705184(-)

Full Sequence      

MSGTDYIIIGGGLAGCALAGRLYEKDSSLQILIIEAGSNVVDHPLTSSPLACFGAHYSPL
DWAYTTVPQTNLDGRQCYNSAGKALGGSSATNYGTWTRGNAVDYDLWAKIVGDESWSYEG
LLPYFKKTETHFNPNVDRSVHGVNGPIHNASVSSSSSERNYPLKEPVKNAWARLGVNHIK
DGNAGSPMGLTELVENWRGGQRQLSSEAYGISSKPGISVLTETMVGRVLVEERDGKIVAT
GVEVADGQKFFASKEVIVSAGAYRTPQILMLSGIGPAEELAKHDIPLVLDSPQVGRNLHD
HFSFNQWWKLRHPEAGLSIGTPLWNSPAYGLGLPCDWNVTIQTPHNELVQALKADGQTTD
LESHPYLAPDFCHSETIVVYAPAGAMIAGVDIPMDGTHIATAVLGMVPTSRGHITLASND
PMTPPLIDPNYYATEVDRAVLRAGIRQVTRLLTDTPEGKEIVECEVPRPGCEPFRADSTD
EEIDSVVKRGGNTFYHPAGSAAMGKVVDTNLRVKGVERLRVVDASVLPLSVTGHYQAVVY
AIAEKAADLISAR

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_137401-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	551	6.9e-153	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.49e-114	5	553	7	534	choline dehydrogenase; Validated
225186	BetA	2.11e-93	5	553	9	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.93e-42	408	546	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.78e-34	70	301	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.47e-28	5	539	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24407.1|AA3_2	1.74e-285	1	553	1	562
EAA58856.1|AA3_2	1.63e-279	5	550	7	553
CAK40717.1|AA3_2	4.34e-279	5	550	6	551
BCS16263.1|AA3_2	2.04e-277	5	550	6	551
BCS04695.1|AA3_2	2.04e-277	5	550	6	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.62e-69	5	552	8	571	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.26e-69	5	552	8	571	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.15e-69	5	552	8	571	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4YNT_A	1.51e-67	5	550	7	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	4.08e-66	2	551	37	598	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	5.71e-142	5	553	6	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	4.33e-74	5	551	8	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A0A3B1EFP9|STR4_STRTC	6.07e-73	5	550	37	611	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P9WMV5|Y1279_MYCTU	5.60e-68	4	550	5	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P64264|Y1310_MYCBO	5.60e-68	4	550	5	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999130	0.000902

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_137401-t33_1-p1.