CAZyme Information: ASPWEDRAFT_121651-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_121651-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		57097.01	4.2335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:772151-773807(+)

Full Sequence      

MKLSLAVAGALAGSAMAIDPIVIKGSKFFYSGNNTQFYMRGVAYQQSYTGSTSTNSSSTS
YTDPLADATTCARDIPYMKELRTNTIRTYAINPTANHTECMQMLADAGIYVITDLSDPSL
SIDRSDPSWEANLYDRYTAVIDEMQQFNNTLGFFAGNEVSNSVSTTDASAFVKAAVRDMK
AYIKQKGYRALGVGYATADDSSIRVNMADYFNCESTEDGIDFWGYNIYSWCGNSTYEESG
YKDRTEEFRNYSVPVFFAEYGCNEVTPRQFTEVSALYGDTMAEVWSGGIVYMYFQETNNY
GLVSVVDSTSVSKMEDFTSYSNHIATATPSGTNKASYTPTNTALQTCPAVNTASWQAKAT
PLPPTPNKELCTCMNDAAGCVVSDSVDSSDYGDLFSLICGYTSCDGISANATTGEYGAYS
MCQSKQQLNFLLNKYWEAQDKSASACSFGGSATTTATTKATGSCSSLMGEAGTAGTGTVT
SKPTASGDSGEVSSSTSSTSSGSAAMTGSMAVHVGSFQLSAYIATAVLAGIGMIAL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	17	325	1.1e-136	0.9807692307692307
CBM43	380	465	3.6e-21	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.61e-157	10	327	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	5.19e-24	391	451	14	74	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	8.84e-11	391	466	14	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE66482.1|CBM43|GH72	1.20e-266	1	536	1	531
QRD92751.1|CBM43|GH72	4.89e-266	1	536	1	531
QMW36259.1|CBM43|GH72	4.89e-266	1	536	1	531
UDD65514.1|CBM43|GH72	4.89e-266	1	536	1	531
QMW48313.1|CBM43|GH72	6.93e-266	1	536	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.97e-124	21	436	36	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	5.53e-124	21	436	36	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	5.53e-124	21	436	36	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XVI5|GEL4_ASPFC	2.15e-181	1	536	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	2.15e-181	1	536	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|D4ATC3|GAS1_ARTBC	5.51e-181	4	534	5	543	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	3.91e-173	22	453	17	450	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	4.32e-173	22	453	17	450	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000317	0.999637	CS pos: 17-18. Pr: 0.9644

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_121651-t33_1-p1.