CAZyme Information: ASPWEDRAFT_121624-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_121624-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	KV878218|CGC12	72740.90	6.2853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:571102-573049(+)

Full Sequence      

MSVALRSLRIRLRKLAQWLELDNIGLPWQRHERYSSVATNSKRPQSSFFRANRLCIVAIP
AVLILFILFAFADPRVPILYKPLPLSEDAPCDHPVLRLATESEKTFNATVKRQSKSLSEA
VTEYKRRYNMPPPPNFDKWYEFAKARDTVLIDEYDTIYHSLLPFWGIKPSVLRARARENL
GRDNGLMGVSVRQGAPIYLSDGQGDFQPSATMAMIQTFSQWLPDMDLGFNAHDEPRVVVP
HDELDQMVKRGREAQFRLNSNRQPEGNFSRTPKELAEPIERVNQTRFAQIDRQETWLLLR
LSCPVDSPARSLDGDGTDNSTDFALGPLGFISNHTAFGDICQSPSLRHRLGVFDRPNSCR
ITQELSPVFSMSKLSSSQDIPYPSPWYYGDQTVYDDDLAVNWEDKIPQMYWRGSTTSGYS
DLGAWRNQLRQQVIAKLAHPWNTTQIYQEANETSACKAHGKKGWERTDVAAVEYQQFFNT
NFTEVKQCAEGDCNDQLAFFDLAHLDNQGDAWKFRYLLDMDGNAYSGRFYAFLRSNSLPL
KLAYFQEWHADTLIPWVHYVPVSHETTEYVELIRYFENDAEGQEIARHMASAGRDWAKTS
LTKANMEVYMFRLLLEYGRIVDDNRENIGYYG

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_121624-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	344	621	1.4e-70	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.02e-22	367	619	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.48e-12	367	619	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85771.1|GT90	1.22e-221	88	632	84	632
BCS23432.1|GT90	3.21e-218	91	630	76	622
QQK42027.1|GT90	1.43e-214	57	629	62	626
CAP94138.1|GT90	6.40e-214	84	630	77	620
CAP97161.1|GT90	1.27e-210	5	617	16	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.18e-07	367	621	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.34e-07	340	624	91	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.29e-49	93	627	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	2.71e-08	362	621	158	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	2.66e-07	367	621	164	389	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	6.20e-07	367	621	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	7.78e-07	340	624	119	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999869	0.000130

TMHMM  Annotations     

Start	End
49	71