CAZyme Information: ASPWEDRAFT_121000-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_121000-t33_1-p1
• CAZy Family: CBM63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		50694.87	4.5359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878217:785459-787091(-)

Full Sequence      

MFTSSPWRLCRALCSPLGLLFAAQVTQAIDLNIDDTQSIKDAASNAAYGSMVWYKGNETG
QIPGAFPTKWWEGGALFYSLIEYWYFTGDDQYNEVIQQGMEWQAGEGDYMPANYSSYLGN
DDQVFWGLAAMTAAELKFPDVKGKYSWLSLAQGVFNTQAGRWDTATCGGGLRWQIFPYQA
GYAMKNTISNGGFFQLAARLARYTNNQTYTDWAEKVWDWTASTPLMNNETWQMADSTTLE
TNCKSQGNEQWSYNYGSYMAGAAYMYNYTSDEKWMPRTKGLLGVIMKRFFQNDIMTEYLC
EPNEACNNNEILFKGLMSGWLAFTTTLIPSTYDTIMPKLKTSAIGAAKSCTGNGNNTCGV
RWSQSKWDGWTGMEEQISATRIFSVNLMDTKKGGAGPVTDKTGGDSKSNPGAGGGSSSDD
DDKDKLKPITTGDKAGAGILTALFLGVWASMVVWMVMAG

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_121000-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	35	400	9.7e-104	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	7.38e-178	38	379	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	7.18e-05	168	350	133	303	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65580.1|GH76	1.45e-224	24	457	20	454
UDD65266.1|GH76	8.35e-224	24	457	20	454
QRD92992.1|GH76	5.06e-223	24	457	70	504
UDD65265.1|GH76	5.06e-223	24	457	70	504
QMW48108.1|AA3_2|GH76	5.97e-213	24	448	20	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.71e-100	33	403	30	416	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.80e-118	17	443	10	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	7.55e-109	29	443	19	432	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5ACZ2|DFG5_CANAL	2.23e-106	19	456	13	450	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.41e-104	17	456	12	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	2.31e-103	26	457	16	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000377	0.999596	CS pos: 28-29. Pr: 0.9742

TMHMM  Annotations     

Start	End
435	457