CAZyme Information: ASPWEDRAFT_119811-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_119811-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	KV878216|CGC2	52433.31	4.3293

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878216:308620-310346(-)

Full Sequence      

MYLLTLLFSTLATAQLIGPVGPTTSLSAKTIECNILDYGGVADNSTDISTALESTFNDCV
RTNPGSRLIVPEGEYLINRGVVLSNATNWAFQLDGLITAAYGGNWNIDRALILEGYAGVD
VLNATINGEGDQKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYLYRNLNNTDRPRLVRLI
SPTNASVHDLILVDSPKFHIILDFAVNVEAYHLTIRGANLGSYDGLDAIGTNYYIHDNEV
TNRDECVSVKSPSHHALIENLVCNQAGSGISIGSLNVSAEISNIVARNISIIQGNNIAFI
KTYPGGSGYVTNITFDNFRSKASLYGLNINQYWQNTYEPDTGAVTLSNLVFRNFSGSVAD
GAKRPPLYFIGNDLTYVTNVTVEDFSVWTESGDFVVNKINNIFGTGDDSYGENNGISSLA
AGETPHTYTSSYTITASPTSWTAPPSPAWAAPSTGYGTASPIPVYSPAPLWRAGGVDYDL
HYWGSF

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_119811-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	129	393	8.6e-49	0.7384615384615385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.20e-21	156	387	61	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.58e-18	24	359	60	383	polygalacturonase ADPG
215426	PLN02793	2.65e-17	184	394	187	401	Probable polygalacturonase
227721	Pgu1	4.90e-16	17	317	68	392	Polygalacturonase [Carbohydrate transport and metabolism].
178580	PLN03003	3.41e-15	34	357	25	330	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57693.1|GH28	6.56e-310	3	486	4	487
QRD82401.1|GH28	6.56e-310	3	486	4	487
QQK39531.1|GH28	5.88e-302	11	486	14	489
QMW40025.1|GH28	4.30e-287	3	474	4	475
QMW27954.1|GH28	1.75e-286	3	474	4	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	6.74e-87	15	463	1	404	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
3JUR_A	1.60e-08	32	349	27	381	The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
1CZF_A	3.90e-08	214	364	173	324	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1K5C_A	4.63e-08	124	343	41	273	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]
1BHE_A	1.23e-06	174	365	151	351	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	1.61e-94	3	479	6	436	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	9.60e-93	11	464	15	422	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	2.69e-92	11	464	15	422	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q2TWN8|RHGB_ASPOR	5.60e-88	7	390	14	363	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1
sp|Q1ZZM3|RHGE_ASPNG	1.27e-87	14	464	22	429	Probable rhamnogalacturonase E OS=Aspergillus niger OX=5061 GN=rhgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000325	0.999635	CS pos: 14-15. Pr: 0.9628

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_119811-t33_1-p1.