CAZyme Information: ASPWEDRAFT_119408-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_119408-t33_1-p1
• CAZy Family: AA8|AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	KV878216|CGC15	59592.22	5.0231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878216:241746-243641(+)

Full Sequence      

MATERAEYRFSLVIVGAGAAGCVLASRISEARPDTQILLIEAGVGRDERVIPAAGYLPGM
GSDIEWNYRSEPQTSFADEDVSLTSGKIVGGSSAVNFQCFTRGPSVNYNQWADLVGDERW
SWKNLLPYFKKSEAWTPSQAMIEEDTPTEDLHGANGPIKVTHVTNSGKPRKYPLRNKIQE
FHEILGQQKIVDLNGGFPRGYAECASSHFNGFRSFATSYKLGDNVTVWTESVVEQVIMNG
KKAEGVLVTRVGEKGERVRAMADKEVILSAGTQASPKILMLSGVGPKSELDRHNIPQIAN
LPVGENYAEHPTLSMYWTVGEANATLGGAEPQTPECDWLAGIPFDWQSFSPADESTRAKA
KEELSAPDYQQYIADGKVQMEVFVNPIPGWPGKRTISLVNVLVDPLSRGTIKLRSSNPFD
APILDPKLLSSPVDRSAFYESVRTTAAAIQKVHSLGAVEFGVDEDLRKDWSDKAVETRIK
RSGGTVYHPSGTCAMGSVVDTECRVLGIEALRVVDASVFTIPLAAHYQAPTYAIAEQMAD
IILDSF

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_119408-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	544	1.7e-133	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.39e-97	1	543	1	532	choline dehydrogenase; Validated
225186	BetA	3.52e-93	13	543	11	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.54e-36	405	536	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.47e-28	83	312	21	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.24e-20	224	519	234	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10581.1|AA3_2	3.13e-229	5	545	2	550
CAK47171.1|AA3_2	1.09e-166	154	545	23	426
QKX63105.1|AA3_2	3.20e-137	3	539	422	968
UPL01281.1|AA3_2	5.99e-124	125	543	1	423
BCR98132.1|AA3_2	5.31e-106	5	282	2	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.78e-60	10	542	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.81e-60	10	542	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4UDP_A	1.17e-50	10	543	6	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	4.28e-50	10	543	6	528	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
3Q9T_A	1.28e-49	10	542	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.10e-79	10	543	5	519	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	3.04e-62	10	542	41	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q39A44|BETA_BURL3	1.77e-61	1	542	1	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1
sp|A4JJG6|BETA_BURVG	3.43e-61	1	542	1	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1
sp|Q4ZM63|BETA_PSEU2	4.97e-61	3	542	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.911503	0.088506

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_119408-t33_1-p1.