CAZyme Information: ASPWEDRAFT_116569-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_116569-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	KV878215|CGC2	20994.50	4.6553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878215:2313337-2314067(+)

Full Sequence      

MQLLSILGALAFVPAVISSPVTGDKLLARDDDRGNYTVAGLGARKQEVVGAGGTTRDLAI
AMLETDTMTTDYTYGDGKTGDGTNFGIFKQNWYMLRTSSSEFMGETTAQVADGAILNSDL
GKDIKARHDGEEKLGFDIWFAGHRDGQSGVEKPNTPDIKGYKDAVLWIQEQIESDKKYQS
DDTRFWVKVKAI

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_116569-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH134	34	192	7.5e-80	0.9937106918238994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381622	mannanase_GH134	1.24e-82	31	192	1	162	glycosyl hydrolase family 134 inverting endo-beta-1,4-mannanase. glycosyl hydrolase family 134 beta-mannanase (E.C. 3.2.1.78) differs from other mannanases in as it has a hen egg white lysozyme fold and cleaves beta-1,4-mannans with inversion of sterochemistry. Beta-mannosidases are enzymes involved in seed germination and the degradation of the hemicellulose fraction of soft- and hardwoods.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60968.1|GH134	1.94e-106	1	192	1	191
CRG88505.1|GH134	9.11e-103	1	192	1	192
CAP81003.1|GH134	3.66e-100	1	192	1	193
CRG89091.1|GH134	2.77e-97	1	192	1	192
CRL29102.1|GH134	2.35e-96	1	192	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XTJ_A	1.16e-69	32	192	2	162	Mannanase(RmMan134A) [Rhizopus microsporus],5XTJ_B Mannanase(RmMan134A) [Rhizopus microsporus],5XTT_A Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XTT_B Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XU5_A Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XU5_B Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XUG_A Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUG_B Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUL_A Complex structure (RmMan134A-M6). [Rhizopus microsporus],5XUL_B Complex structure (RmMan134A-M6). [Rhizopus microsporus]
5XXA_A	7.71e-68	32	192	2	162	beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus],5XXA_B beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus]
5JU9_A	3.91e-62	34	192	10	168	Structure of a beta-1,4-mannanase, SsGH134, in complex with Man3. [Streptomyces sp. NRRL B-24361]
5JTS_A	4.59e-62	34	192	15	173	Structure of a beta-1,4-mannanase, SsGH134. [Streptomyces sp.]
5JUG_A	1.12e-61	34	192	10	168	Structure of an inactive (E45Q) variant of a beta-1,4-mannanase, SsGH134, in complex with Man5 [Streptomyces sp. NRRL B-16215]

Swiss-Prot Hits     

ASPWEDRAFT_116569-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999700	CS pos: 18-19. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_116569-t33_1-p1.