CAZyme Information: ASPWEDRAFT_115539-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_115539-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		65161.35	5.2480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:2243152-2245034(-)

Full Sequence      

MAIPIPALSTFKDFDYVIVGGGTAGLVLAARLSEDPTITVGVLEAGKSRLGDENVESPAG
MGNLLHNPEYDWVYESTPQAGTNNTVHHIARGKLLGGSSGINYLAYCRPAAQDIDFWEQL
GNKGWNWSELRPYYHKSESLHGKAGPAVENKPDFFANNPRSHGSSGPIQTSFAPWRVPVE
DSIIAALSELSGVEASKDPWDGDHLGIYGSLSVIDTRKGGGSRSYAATGYLAPIIGRPNL
QVLTDATVCKVLLEQSDSLTARGVEFSYDGATHSVHARQELILCAGTIQSPRLLELSGIG
DPQILGAAGVECVLRRPEIGNNLREHPMTSITYELAEGQISLDSLFNESTALAAKQQLLG
TDGGSDSLNGAMGLAGFLPYASLVSTEELNSMVSQMDDEEVYPIEEKQDLAARLRNPKYG
AVQVVGCPANFDVSAGHADQRRLMAGPPPGRNACYAFLLSLATPLSRGSSHITSADAFAV
PQIDLGLLSHPMDADVLAGGLDFADRVFRSSRVADKVAGRVDPPPEINLRDRRQGREFVR
SHTTVFNHMLGTCAMGHVVDERLRVKGVSGLRVVDASVFPTQISGNIMATVYAVAEKAAD
MIKEDHFK

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_115539-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	605	1.9e-167	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.51e-95	12	606	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.07e-93	9	603	1	532	choline dehydrogenase; Validated
274888	Rv0697	1.61e-59	15	602	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	6.03e-37	464	598	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.99e-31	14	591	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47931.1|AA3_2	5.27e-204	14	605	14	617
UBX54549.1|AA3_2	1.45e-203	14	606	14	611
UPX44764.1|AA3_2	2.94e-198	14	606	14	612
ALI92648.1|AA3_2	5.90e-198	14	605	14	611
AMU19396.1|AA3_2	5.90e-198	14	605	14	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.57e-71	13	605	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.48e-71	13	605	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.89e-69	14	605	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.69e-66	12	606	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS1_AAA	5.97e-59	12	602	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.05e-198	14	605	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.05e-198	14	605	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	9.86e-194	15	606	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	4.72e-82	12	602	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.72e-82	12	602	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999954	0.000098

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_115539-t33_1-p1.