CAZyme Information: ASPWEDRAFT_114784-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_114784-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		63723.01	6.2017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:2515391-2517221(+)

Full Sequence      

MMESTQSWDFVIVGGGPAGCNLAATLARSDKRPQVLLLEAEAKNDDKSLRVDGQRWTTFL
NGELNWGYKTTPQEHCNGREIDYSRGKVLGGSSAINFGFYTVGARDDYDQWAAIVGDETF
RWDRMKARFKKLENFNGVIPNTKNAKYATPKPADHGSQGNLRVGYANEWEQDLPLMMDIF
EQAGLARNPDHNSGDPIGMALVINSAHQGQRTTAADLLLGAPDNLTVITEAPVQRVLLQG
KKAIGVESRGKQYIANQEVILTTGAQDTPKILMHSGIGPADQLREFHIPVVQNLPAIGQG
LRDHFFVPLCFQRKPETNDRNAFFRNPAAMDAALEQWKKDRTGPWTRHSCQLGAGWLKSD
RVTASTEFKALPLAEQDFLQRETVPHYELVTHFPLHLIFPEAVPDYSYVCLSVFLMNEQS
NGEVRLQSSNPDDPLLFDPKFLSHPFDRRACIEIYRHVLEISKHPAFSKDTVSTLIAPAS
ESDEDILEFWKNNLASGWHMMGTAKMGKPGDIDAAVDKRFRVFGIDNLRVADLSVVPVLT
NNHTQATAYVTGATCADILIREYDLNMAQRP

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_114784-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	560	3.6e-153	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.27e-96	1	562	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.93e-87	4	561	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.14e-39	419	555	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.19e-32	6	552	54	569	Protein HOTHEAD
366272	GMC_oxred_N	3.03e-23	76	304	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46531.1|AA3_2	0.0	1	569	1	569
BCR99292.1|AA3_2	0.0	1	569	1	569
BCS11595.1|AA3_2	0.0	1	569	1	569
BCS19530.1|AA3_2	1.77e-275	1	569	1	570
EAA62931.1|AA3_2	3.42e-267	2	566	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.23e-62	8	559	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.32e-62	8	559	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	8.30e-58	2	564	35	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS1_AAA	3.40e-47	6	559	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
3Q9T_A	4.61e-47	8	563	7	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.98e-64	7	559	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.22e-64	8	565	2	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q47944|SDH_GLUOY	5.42e-63	5	559	2	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q0CJ60|ATC_ASPTN	1.50e-61	1	560	39	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A0A2V5GRB0|PYVF_ASPV1	2.73e-60	9	557	53	610	Dehydrogenase pyvF OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000008

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_114784-t33_1-p1.