CAZyme Information: ASPWEDRAFT_114625-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_114625-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	KV878214|CGC16	44837.03	5.1677

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:2469302-2470616(+)

Full Sequence      

MLPYLPLGLLGLFPQIIASTCDARPYSAWMADSVIGRGQATVAPGDKPSASTYLQIGFFQ
TAILRLKEYYDTPESACAQSDWEEYLRTSTDSIAPFLLNATHDTEYPLDRLSTGRGLTYQ
YKQAGNITANSAENALRESINLQPRNQFGGYWYFTYPEWSYLDGIYSLVPFLSYYTTNFD
STNSSAVAGDIIHQLDLLWSHCRHNSTGLLVHGYDASKNASWANPVTGGSPIVWGRSLGW
YLMALVDTLESMTPGFPHELKEYLHRRLVELTASVVAAADPETGCWWQAMNYPGREGNYI
ESSGSAMFTYALYKSARLGYLPDRLSGKSSDTANQCRNHLVDSFVVDNKNGTLGYNGTVS
VCSLNSSATYEYYITQPLLYNSVHGTAAFVLASLEHEISEHAKQ

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_114625-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	396	2.8e-69	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.52e-44	23	397	12	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	6.26e-37	104	397	68	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85043.1|GH105	8.26e-183	14	397	29	416
UDD61061.1|GH105	1.57e-180	14	397	29	416
BAE63195.1|GH105	1.07e-179	14	397	29	411
QMW45474.1|GH105	6.28e-176	14	397	527	914
QMW33436.1|GH105	6.28e-176	14	397	527	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	9.81e-52	105	397	71	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.05e-35	48	397	35	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.44e-35	48	397	25	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	5.39e-35	48	397	35	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	9.33e-29	208	395	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	9.33e-29	208	395	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000333	0.999659	CS pos: 23-24. Pr: 0.5565

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_114625-t33_1-p1.