CAZyme Information: ASPWEDRAFT_113709-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_113709-t33_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	KV878213|CGC16	47175.39	9.8935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878213:2271291-2272685(+)

Full Sequence      

MKSLFESPALIFSASVVLRAILLVYGAWQDAHSAVKYTDIDYMVFTDASRYVSRGVSPYA
RDTYRYTPLLAWMLLPTTWNGFFAFGKVLFALSDVLAGWLIAKSLMANYGMDSSRALKYA
SVWLLNPMVANISTRGSSEGLLCVLVVALLWAVLNRKVTMAGFILGVGVHFKIYPFIYGP
SIIWWLDAERDGSKTKTSTKDTTKNTSLLSQISAFITPSRVQLTLTALATFSALNISMYI
LYGLPFVHHTYLHHLTRIDHRHNFSPYHTLLYLSAAGNVQTSFESLAFIPQLLLSVVLIP
LVLAKKSLPGAMLAQTFAFVSFNKVCTSQYFLWYLVFLPFYLPNSSLMKRPRLGISAALL
WVVSQALWLQQGFNLEFLGLSSFIPGLMFAGWFFFAVNVWILGIIVTDVGGVSRPADGKV
HAD

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	405	1.7e-95	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	2.23e-82	14	406	14	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.46e-67	132	406	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	7.66e-231	1	409	1	410
BAE66105.1|GT50	1.92e-230	1	409	26	435
QRD92382.1|GT50	1.26e-229	1	409	1	410
QMW36573.1|GT50	1.63e-229	1	409	8	417
QMW48628.1|GT50	1.63e-229	1	409	8	417

PDB Hits     

ASPWEDRAFT_113709-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	1.36e-231	1	409	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	9.75e-225	1	411	1	423	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	3.53e-208	1	419	1	438	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.35e-163	11	423	13	422	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.30e-161	1	410	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999508	0.000523

TMHMM  Annotations     

Start	End
10	28
69	91
132	154
161	183
225	247
282	304
319	341
353	369
384	406