CAZyme Information: ASPWEDRAFT_106734-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_106734-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682		75095.43	4.8683

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:862083-864237(-)

Full Sequence      

MAELQLSRFLLIFLVLLPHSLAQQCWRNTSCSGPTESAFSGPWEQNIYAPSSRTVKPKRI
LSTTNTNTSNYTESQIPTLRGNGSPVVFDFGLEVGGIVTLNYTSTGNGALGLAFTEAKNW
IGEWSDSSNGGFKGPDGAIYANFTKAGDGTYVMPDEKLRGGFRYMTVFLIASDSVEVRIE
GISLELAFQPTWSNLRAYQGYFYSDDELLNRIWYSGAYTLQTNAVPVDTGRQVPMVNEGW
ANNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSSFVSTGDLESVKNALQAMYDTQDQST
GAFDESGPPLSQKDSDTYHMWSMVGTYNYILYTEDTDFLSKNWNGYQKAMNYIYGKMDNS
SGLLNVTGTRDWARWQQGYNNSEAQMILYHTLRTGAYLASWAGHATQLADTWNSRADSLR
IVINQYCWDDEYGAFKDNATETALHPQDANSMALLYGVVDKERAARISERLTDNWTPIGA
VTPELPENISPFLSSFEIQGHFTVGQPARALELIRRSWGWYINNPNGTESTVVEGYLQNG
TFGYRSSRGYDYEESYISHAHGWSAGPTSALTNYILGLSITSPRGSTWKIAPQFADLRSV
EGGFTTSLGKFHASWVKGSKGYTLDFSVPAGTKGNLTLPYVESSKKPSIMIDGNNVTRGV
YYIDETATVTVSGGGSYKVIVS

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	85	638	3.1e-97	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.57e-08	200	473	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.14e-06	577	639	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
273702	oligosac_amyl	0.008	312	489	351	525	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225990	COG3459	0.009	388	474	763	857	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	0.0	10	682	13	686
QRD88907.1|GH78	0.0	10	682	13	686
QMW37218.1|GH78	0.0	10	682	10	674
QMW25160.1|GH78	0.0	10	682	10	674
BAU45349.1|GH78|3.2.1.174	0.0	1	682	1	680

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.06e-22	145	639	491	942	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	6.91e-17	86	612	194	673	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPWEDRAFT_106734-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999755	CS pos: 22-23. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_106734-t33_1-p1.