CAZyme Information: ASPWEDRAFT_102583-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_102583-t33_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726		79845.81	5.6012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:233854-236034(-)

Full Sequence      

MSSEYTFQDAVAAVQSGQPLTEATHTLLSHLTKDERLSLLDGDVDFWPGMRSMVCDRYNP
APYVHGAIPRLQIPGIRFTDGPRGVVVGNSTAFPISMARGATWDVELERRVGHAIGLEAK
AQGANFFAGVCVNLPRHPAWGRVQETYGEDPLLLGEFGLALTESVQNHVMACVKHYALNS
MENARFRVDVRVDEAVLHEVYLAHFRRIVQGGVAAVMSAYNSVNGEWAGQNQHLLNEILR
GQWGFDGLIMSDFVFGLRDATKSVRNGLDIEAPFRQQRAMHLAAAVQDGELEWDIIDRSS
ERILRKQVEFAIRTEKSNPDPGVVFCDEHRALAREVASRSIVLLKNEPIDGKPLLPLQAA
SLKRVAVVGRLAAMPNTGDKGSSQVFPPSVVTPLEGIRDALPHVEVRHAESVKDATRLAS
EVDAVICIVGYTYKDEGEYMVPALQEDPVLGDVLPPDRTGEERETVAISQGKGKHDGGGV
AAGVGGDRTSLRLREDDEKLVQAVQARNPHTIVSIVTAGAVVMESWRAKVPAILMSWYSG
SEGGHALADVLLGTVDASGRLPFSIPTDERHLPFFDIHAAQIDYDRWFGQHLLDKLGVPP
AFPFGFGLSYTTFLLQEIATCQQEKEKLQIKVSVKNTGLRGGWLIAQVYGLPGVDDFPAR
LLLGFHPVYLEPEQEKLIPVTASLRPVQRWREGEFVFQSTDMVVEVSRFAGDPDAINIRT
SLMDVR

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_102583-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	271	2.5e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.10e-67	70	678	101	721	beta-glucosidase BglX.
224389	BglX	1.08e-63	67	400	54	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.27e-47	341	610	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.38e-46	2	669	37	729	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.02e-36	70	305	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC95327.1|GH3	0.0	2	722	4	725
UCK59088.1|GH3	0.0	4	723	6	726
BAE55411.1|GH3	0.0	4	723	6	726
QRD87369.1|GH3	0.0	4	723	6	726
QMW26514.1|GH3	0.0	4	716	6	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.87e-77	27	707	8	665	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.32e-75	22	706	2	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.80e-74	22	706	2	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	1.49e-67	12	690	42	795	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	6.43e-63	20	720	1	662	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	9.62e-77	27	707	8	665	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	1.52e-76	27	649	5	734	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A7LXS8|BGH3A_BACO1	2.21e-76	58	688	63	710	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	3.09e-69	26	712	13	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BB53|BGLI_EMENI	2.46e-67	28	690	10	797	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_102583-t33_1-p1.