CAZyme Information: ASPWEDRAFT_101556-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_101556-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	KV878209|CGC3	54938.26	5.8295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:1908663-1910114(+)

Full Sequence      

MLLRVGERPGWGTSWAWKKFVRFGVAFLFITTFALLLWPQINTKHVVVHTAGHNITISSD
VKCDNLNFDVLGRLDVRKLSKYMRREIIAVPSSAQGIPITQRVQTPLFDTKKLNAEDTVT
VQQQLQADCSNPFPITVHVPTSPKTVDASHIDFGVATTLKRLNESVDQFAHWAGYTKTRI
FALVEPDDRVNEVQAKADTLGINLYVTQSDEEYQTRYFSLIAHLAENMREQTRWSVVIDD
DTFFLSMSALVQALGEYDHTKPAYIGGISESVPQVGNFGLMAFGGAGVFLSRPLVLELSS
SDIFDACQHMEFTGDRRISLCIYQYTTTRLTIDHRLRQLDMMGDVTGFFEAGRELPLSVH
HWKSWFHYDMSKVSTISDLCGDNCMLRKWFFNDGWVLTNGFSVVKYSSDIDPDDKTMELT
WESHNGAVHESYLHELGPLRPKDWDKVSYLIADSVVEGDTVRQWYINRDPNGDQVLELVW
RSG

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_101556-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	3.94e-12	233	361	212	341	hypothetical protein; Provisional
367085	Fringe	1.24e-10	146	299	1	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	3.30e-05	281	361	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85752.1|GT31	1.12e-255	1	482	1	482
BAE58287.1|GT31	2.91e-235	1	482	1	484
UDD56605.1|GT31	2.91e-235	1	482	1	484
QMW40633.1|GT31	8.30e-235	1	482	1	484
QRD83076.1|GT31	4.78e-234	1	482	1	484

PDB Hits     

ASPWEDRAFT_101556-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPWEDRAFT_101556-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000007

TMHMM  Annotations     

Start	End
20	42