CAZyme Information: ASPVEDRAFT_97195-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_97195-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KV878126|CGC24	47380.82	6.8942

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:3162095-3163449(-)

Full Sequence      

MHKPTILFLTNSELGQASVVLAVAHELVHHSDVLVASFPALKTHADALSVPFHALPGRSM
KETLADSGLPYLPQHAPGRQGAVESYRNGLQRVVAPWEPEGYAPIYRACLDLISKLSPAL
VVVEPLFGPGQDACNVLEQRYLVLSPATFKDHLVQAQPYLGVLWKYPVISSGLPYPIPLR
LIALNIYLIFKLVTTTFLSPRVKDLTQWRNKTGIPGELTTIYANFSETVPWIVPSIPQSD
FPMYIPPNITGCGPILPPFEAIPDDHPTAAWLAQRPTILLNLGSHMKYTVEDAQQVIAAL
DIVLTKYPDLQVLWKCQLSTNNTTTNTNTNSSETKITSLIPKHIYNRILITPWLTPSPAS
ILAHQSTIAAVHHGGSNSFHEALAAGVAQVVCPVWLDTYDFAARVEFLGVGVRGNAVAAP
GVEGGELGRAICLVM

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_97195-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.35e-23	1	431	1	369	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.15e-08	3	413	1	347	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	1.36e-07	219	415	217	389	UDP-glucoronosyl and UDP-glucosyl transferase.
178170	PLN02555	0.001	361	413	350	403	limonoid glucosyltransferase
223071	egt	0.001	360	435	358	430	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD20769.1|GT1	1.46e-291	1	435	1	436
BCS20162.1|GT1	4.89e-273	2	435	4	440
QBE85641.1|GT1	1.60e-223	2	432	4	435
BCR88350.1|GT1	2.63e-103	4	431	2	445
BCS26405.1|GT1	1.00e-100	1	435	1	447

PDB Hits     

ASPVEDRAFT_97195-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.85e-224	2	432	4	435	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	7.59e-72	1	435	1	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|P54855|UDB15_HUMAN	5.44e-07	29	409	51	411	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3
sp|A0A0D1DZV5|EMT1_USTMA	3.16e-06	360	427	453	518	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	4.18e-06	361	413	455	507	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_97195-t33_1-p1.