CAZyme Information: ASPVEDRAFT_89541-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_89541-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	KV878139|CGC5	27231.77	3.9349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878139:483072-484007(-)

Full Sequence      

MFIKNSLILSLATSVLATHGARSHPGSKMVKRADFPIPESQGSETFDEPYEISGEEFDGG
MKTYGRGVDCTGQSEGGDSDAVFIVKDGGTLKNAIIGTDQIEGVHCEGSCTIENVWWEAV
CEDALSLKTGDGPFNVVGGGATGAEDKVIQHNGGGTVTVSDFTVTDFGKLYRSCGNCDEM
SERHIVLNGVTATDGKYLVGINSNYGDTATIDSETCATDVKTICAEYEGTDNNDEEPEEI
GDGPSDYCIYTDPLPEC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	41	229	8.2e-80	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	6.65e-115	36	234	3	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21544.1|PL3_2	4.00e-184	1	257	1	258
EAA67075.1|PL3_2|4.2.2.2	1.56e-161	1	257	1	260
ABF50894.1|PL3_2|4.2.2.2	1.56e-161	1	257	1	260
EAA64647.1|PL3_2	9.36e-141	1	257	1	264
BCS21965.1|PL3_2	5.49e-132	1	257	1	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	5.25e-25	53	211	13	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	2.83e-23	53	176	18	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.90e-23	53	176	19	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	2.14e-22	66	242	12	209	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z05_A	2.60e-22	53	176	27	148	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATC7|PLYH_EMENI	2.77e-162	1	257	1	260	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q5BA88|PLYD_EMENI	1.66e-141	1	257	1	264	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	1.46e-123	6	257	5	253	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	2.45e-117	1	257	1	242	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	2.45e-117	1	257	1	242	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001147	0.998806	CS pos: 32-33. Pr: 0.6227

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_89541-t33_1-p1.