CAZyme Information: ASPVEDRAFT_89188-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_89188-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		41571.77	5.4323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878138:526158-527366(+)

Full Sequence      

MFSKSALAVAALLGSSLVDAHMLLVNPEPYNFKSWDNSPIEADGSNFPCKETDYTVTKEN
QMTKGQPQQLEFKGSATHGGGSCQISITSDRQPTKDTKWSVIKSIEGGCMDPNEGDTNSG
TAAGAKSSFTPSFTIPDSFEDGKYTLAWTWFNRIGNREMYMNCAPITLSGGGSSKRSDES
AVKKRAEEYPPLFIANINGCQTKEKKSIRFPNPGDDVESLNESHLLADASSVCDTGSPTW
GGDGMSGGGGSAPEPTSADGGAGSEPTPTASVSVGGAAGVAPIQTGQTTTTQAPAPVAPT
ASSTFVSSPAAPTAAPTSTPGGSSGSTEGALSGACTDEGAWNCVGGSSFQRCASGQWTAV
QAMSGGTQCTPGQNRDFAVKAVEVKSRMLKEKRRRVHGHNHA

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	222	1.4e-72	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237030	kgd	0.004	226	322	19	114	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
237865	PRK14951	0.004	260	320	369	429	DNA polymerase III subunits gamma and tau; Provisional
223039	PHA03307	0.007	234	375	129	270	transcriptional regulator ICP4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27654.1|AA11	2.82e-238	1	402	1	401
CBF74037.1|AA11	6.97e-175	1	399	1	413
UDD60467.1|AA11	5.83e-113	1	402	1	405
QMW31531.1|AA11	8.09e-109	1	402	1	421
QMW43588.1|AA11	8.09e-109	1	402	1	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	5.75e-82	21	233	1	216	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

ASPVEDRAFT_89188-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999677	CS pos: 20-21. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_89188-t33_1-p1.