CAZyme Information: ASPVEDRAFT_89071-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_89071-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554	KV878138|CGC3	61097.29	7.0915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878138:244563-246329(+)

Full Sequence      

MHIAFLTNPASGEVNVQLATAQELVDQGHSVTFLSTAACSSKVSRFRVAQLPCNQHRIHF
ISLGSNQALNDFTRTAQSRMHLMRRVPGDPISLQTCTDASVGPAEDHAAMALRVRDHLNE
LDPDMICVDALTSSVITGVRLTKREFILTVPCSPGMTALRSAFQPHMVAANRRGSWGTFF
ENMYLNLHEVIHSRRHPYRREQRKVIKRLGLQSYGTARDSACMGPNWQDENCVAGIHFNT
PGLIDCPKQSPKMVFVGAGVAAEHSPSPFTPPPTMPPTPSMDPIGAFPELAWMDEAAARG
EDVVYMNMGSMFLWRPDEFDACIEGFKAAHRRLNGRVRFLFKINRAPQSRSSTSNTTPEK
EKENIAERELSIEDLDLTLPPFIRLTHWISNQTAVYTHRALKAFIHHGGGNSFNEAVHFA
VPQLVLSQWLDTHEYASYAHRFGLGLRSEHPPSIQACDVEAKILELLGPRWAEFKATCQS
WALRSELGGGPAAAARIVLFHAQLCAAEAGARRKESGDGSGSGSESSTETELTPPLSPEQ
VSGFEKDVKEIAIS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_89071-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.69e-27	1	501	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.42e-10	1	513	2	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	1.22e-05	290	500	260	449	UDP-glucosyl transferase
273616	MGT	6.98e-05	300	499	224	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
215465	PLN02863	0.003	290	424	274	385	UDP-glucoronosyl/UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27825.1|GT1	8.50e-287	1	554	1	555
EAA58772.1|GT1	6.16e-190	1	553	1	485
ATY63993.1|GT1	3.06e-172	1	503	1	474
CDU26159.1|GT1	2.65e-114	1	517	1	581
SJX63359.1|GT1	2.02e-113	1	498	1	562

PDB Hits     

ASPVEDRAFT_89071-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M9MH90|EMT1_PSEA3	2.17e-119	1	504	1	565	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.61e-118	1	504	1	564	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	1.11e-07	3	463	8	434	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_89071-t33_1-p1.