CAZyme Information: ASPVEDRAFT_889579-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_889579-t33_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		83313.39	5.4511

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878130:197513-199939(+)

Full Sequence      

MKCGMLALLGNGTLLKLSSDGVTPAVVVLDYGWNVEGYATFQVSQRSGDTSSFEMTYSES
RALLESEMGDGPLPLAGAMDTYRVNRYNITEQQTYTNRLIQGGLRYQKLNLSSAGEIHLS
MVGFKPTVSSTPLAELPGSFNCSDEVLTRIWHAGARTSQLNELPANSVPDFWILTDEGAF
VDSLAPQPYYSDWSPSLMTYDLEFLVKPISKGFGFTVLSDTLSSGVYIFVNIANASISAH
AGSSELGATLASGTLSDSITLNDWHRVQSNVNLSQVSVNINNITVLDFSQNTSFYGSFGV
GASLGHSALFTNLSLSVDGEEKYFSTLKDKAALQDFLLGTNPLPVSVDGSRRDRIAYAGD
LDMASRTAFASTNGLEYINGSIELLGSYQLSPGFFVPNAKIQQPPRTAEIQANITGLIGY
SFSLVNAMANYYEQTGDHVFLNRWAPKAVRLLDWAHSQTLSNGLLNISDSSMGGDWNYYD
PALSGVVSKFNIVYAYSLKQWLPYLSQAGLNDTLYQGRLQSLQKAINAHLWSDKLQAYYQ
SETHQDFFSQEANALAILSDTSSLSNRTSILLSTMARELYVPNGALPFSNASAASGWAQK
ISPYSSGYHLKAAFHANDSVAAKRLLHTLWGPISDPNHANYTGCMWEVMHVDGTPGLDSP
TSLCHAWGAAPTADLSRYVLGIQPKTPGFKEWKVVPQTMDLAWARGDYPTPSGKISVDWS
FDWRGRYRIVVDAPAGTKGTVYLPSPLRGSFEVQGGKTFRYQE

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_889579-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	342	743	4e-69	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	8.93e-13	681	759	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	6.76e-04	341	679	27	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD63660.1|GH78	0.0	11	759	260	1025
QMW46762.1|GH78	0.0	11	759	47	812
QRD93478.1|GH78	0.0	11	759	243	1008
QMW34696.1|GH78	0.0	11	759	47	812
BCR85243.1|GH78	0.0	14	763	44	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.92e-18	396	749	604	947	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.16e-17	347	717	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPVEDRAFT_889579-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_889579-t33_1-p1.