CAZyme Information: ASPVEDRAFT_886969-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_886969-t33_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		64609.28	6.4549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:1849960-1851705(-)

Full Sequence      

MPVQDNARFDFIVVGGGTAGNIVAARLAENPNAKILVVEAGVANSKDIEDIRTPANAMEL
RDSQYDWAYKTTMVKRDDYERVEKPNTRGKALGGSSSLNYFTWVPGSKGTFDMWEEYGGK
EWTWDPLVPYLRKSATYHDDEKAYSPDLKKIGAGGPIPISHSELIPEMQPFRDLLTKAWK
STGQPINENIFDGEMVGLTHSVNSIYRGRRSGSFLAVSDKPNITILPEVHSKRLIIDNAD
KTCKGVTVITQSGQELNLFANREVIVSQGVFESPKLLMLSGIGPATELKKHGIPVIVDNL
HVGQHLLDHPGVPFVLRVKDGYGMDDYILRANTAQNKQAIQAYQNNHGGPLGSGFLEMVG
FPRIDKYLDKDPQYRQAKASNGGQDPFCPYGQPHFELDFVCLFGSAFQWHYPTPAKGNYI
TVMVDLVRPVSEGGEVTLNSNDPLQQPNINLNYFNNDLDIIAIREGIRFAYDVLKNGDGF
KDIIEAEYPWDMPLHDDKLMKRTVLDRSQTSFHPCGTARLSKNIQQGVVDPGLKVHGVKG
LRVIDASVIPVIPDCRIQNSVYMVGEKGADAIKRDHADFYK

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_886969-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	575	1.3e-153	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.30e-82	9	577	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.39e-82	8	581	5	546	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.72e-39	429	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.76e-29	4	575	52	579	Protein HOTHEAD
366272	GMC_oxred_N	1.82e-21	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90169.1|AA3_2	0.0	1	580	1	580
QKX59780.1|AA3_2	0.0	1	580	1	579
QKD59313.1|AA3_2	0.0	1	580	1	579
QLI67929.1|AA3_2	0.0	1	580	1	579
QGI68848.1|AA3_2	0.0	1	581	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	5	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	5	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	5	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	8.06e-73	9	575	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.61e-72	7	575	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	3.87e-61	3	577	35	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L1D1|PDH1_AGABI	4.76e-60	9	577	41	594	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|A0A3B1EFP9|STR4_STRTC	5.06e-60	1	573	28	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.39e-58	5	572	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.39e-58	5	572	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_886969-t33_1-p1.