CAZyme Information: ASPVEDRAFT_882784-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_882784-t33_1-p1
• CAZy Family: GT45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		82833.68	4.0079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:4143869-4146623(-)

Full Sequence      

MYSFFRSFAALVAAEKYTDPDTGIIFDTWTVEESSSAAGLTFGVALPEDALTNDATEFIG
YISCSSSATTGATGWCGFSFGPSMNGNLLLLAYPQDDKVLTSFRFSSGYALPEVYAGEAT
LTQISSTVADDGFTVLFRCEGCLAWDHDGVTGNATTSSGRLIMGWAQGQESPTDGACPDD
LSVVQHEGQGIWGAALDENAASSEYETWAALATEKVTGDCDGSGGGGGGGDVVGTPVPSG
SSYEYIVVGSGPAGMVLADRLSETGAKTLLIEKGPPSIGLWGGDMKPDWLNGTELTRFDV
PGLCNQIWVDSAGIACPDNDQMAGCLVGGGTAVNSGLWWKPYSKDFDENFPEGWKYSDVS
GNVDKVFNRIPGTITPSTDSKLYLQEGPSVIMNGLTANGWEMTSFNDAPEAKYRSVGYSP
YMFSNGQRNGPMATYLVNANERNNFDMWINTTVRRVVRDQGTVTGVELEPFLDGGYEGTL
NLTTGGKVILSAGAFGTPKILFRSGIGPEDQLSVVNNSKTDGDTMIAESQWINLPVGENL
MDHPNTEVVVQHPDIVFYDFYGAWDDPVEADMQSYLSDRTGPLAQAAPNVNPVFFDQVTG
PDGVTRQLQYQARVEGSHDIADGHTMSITQYVGRGQTSRGKLTINSGLNTVVSTLPWLQD
DNDTDAVIQGLERLRDSLSNVTGLTWAFPTKNVTITDFVNSLPSTGRGSNHWMGSCKMGS
DDGRDGGSAVVDLDTKVYGMENLFVVDASIFPGMVSTNPSSYIATVAETAAERILAL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	238	777	3.9e-231	0.9762773722627737
AA8	17	208	5.5e-65	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	2.67e-65	17	203	1	176	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	1.29e-58	236	776	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	1.42e-45	17	196	2	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
274888	Rv0697	7.89e-42	244	772	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	8.57e-32	242	775	5	532	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19750.1|AA3_1|AA8	0.0	1	777	1	792
EAA61277.1|AA3_1|AA8	0.0	1	777	1	778
QMW43910.1|AA3_1|AA8	0.0	17	777	85	843
UDD60845.1|AA3_1|AA8	0.0	17	777	85	843
QMW31885.1|AA3_1|AA8	0.0	17	777	85	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	17	777	8	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	3.63e-313	13	776	3	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	2.31e-240	236	777	1	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	2.57e-117	236	777	1	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	3.39e-116	243	777	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	6.97e-141	13	777	20	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|P0DO29|ERIK_HERER	1.02e-24	241	774	32	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q47944|SDH_GLUOY	8.74e-23	241	772	3	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|H6AGY0|EO_BOMMO	2.28e-19	239	774	44	591	Ecdysone oxidase OS=Bombyx mori OX=7091 GN=EO PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	5.75e-19	241	775	44	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998968	0.001061

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_882784-t33_1-p1.