CAZyme Information: ASPVEDRAFT_87423-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_87423-t33_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	KV878134|CGC3	42323.18	4.8673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878134:489225-490531(+)

Full Sequence      

MADSIILRGQAIVEQEGDSSSLMQVGTFQTALLDLLESPSGHYLEEDWESYLSRSADSVV
DVVNNATKDTELPLDRLSAGKGLFYRYDKTEKGIYRDTLSALRTSIDLQPRNRFGGLWYY
VYPNWSYLDGMFSLLSFYPLYTSHSDINNTASVNKDLFHQINLLWGHCHNETSGLLFHGY
DATKTASWANPTTGASPFVWGRSLGWFMIALVDFLELAPIESDSDSQIEIATWRARFVDL
ANAVVEAVDPVSGAWWQVMSAPGRKGNYIESSASAMFTYSLYKGVRIGLLDDKRTNPKHK
GNAKYNYTDVATRAYRSLVDRFVVENADGTLSYNGTVSVCSLNSTASYEYYVTQPLLYDS
VLGSAAFVRASTEHEFQH

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_87423-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	374	3.5e-65	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.85e-40	70	375	75	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.59e-37	26	375	32	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25093.1|GH105	3.30e-249	1	378	35	410
QRD85043.1|GH105	1.68e-136	1	375	45	416
UDD61061.1|GH105	4.44e-134	1	375	45	416
BAE63195.1|GH105	1.14e-130	1	375	45	411
QMW45474.1|GH105	2.40e-130	1	375	543	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.12e-49	1	375	8	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.65e-35	26	375	44	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.64e-35	26	375	34	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	8.49e-35	26	375	44	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.38e-26	171	373	35	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.38e-26	171	373	35	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_87423-t33_1-p1.