CAZyme Information: ASPVEDRAFT_86809-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_86809-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		64815.83	4.7812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878133:325334-327282(-)

Full Sequence      

MTFTKIAVLSLAYITSPCLGLSNQGAPGISWSYDYVIVGGGTSGLAVATRLAEDSGVSVA
VVEAGGHYEIDGGINSIIPGFAAAANTGTDPSDDSLLIDWNFDALPLSAADDRVLRYSRG
KCLGGTSARNLMVYHRGTKDSYDQWADITGDYTWEWESVLPYFKKSCTLTAPDMSKRNAN
SSVTYSADAFDNNMKGPLQVSWPNYGSPFATHVEAGLEAIGILSGQDLNSGYLNGSSWAP
TTIDPKDETRSSSKTSFLKQSLLKLNFNVYANTLAKKINFSGTKAKSINVETLGIPYTLT
AKKEIIISAGSFQSPQLLMVSGVGPRSALEKLGIKVVKDLPGVGQNLWDHALFGVVNRVN
VETASRLVNDQTAATEALGQYALKQGPLTAPGFGILGWEKLPNNVRKHFTNSTRKALDNF
PADWPEVEYISLDGILDGWHSADDQDLGDGYEYGTIAPALVAPLSRGSVTINSTDISATP
VIDLGYLTHPADQEVAVAALKRAREAFNATGIIIGEEHRPGPDVQTDEEILEFIRSTIVP
VWHAAGTCAMGESTNPDAVVDSNAKVIGVQNLRVVDASIFPTLPPGHPQSTCYMIAEKIA
DAIKNGS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_86809-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	32	605	1.4e-182	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.79e-112	32	604	5	532	choline dehydrogenase; Validated
225186	BetA	4.78e-97	32	607	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	8.80e-62	34	600	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	7.27e-48	463	599	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.38e-26	107	350	11	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27384.1|AA3_2	0.0	1	607	1	607
EAA59311.1|AA3_2	0.0	1	607	1	607
EAA63130.1|AA3_2	8.94e-257	23	607	32	611
QIX00622.1|AA3_2	2.49e-190	1	606	1	606
QDS73883.1|AA3_2	3.15e-189	1	600	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.05e-70	32	604	5	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	3.38e-63	33	604	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.78e-62	33	604	3	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	3.58e-61	33	597	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	3.33e-55	32	604	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.59e-257	23	607	32	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	3.88e-165	32	600	51	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	4.97e-163	22	600	41	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	3.75e-157	32	603	45	593	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	7.02e-150	5	603	8	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000750	0.999229	CS pos: 20-21. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_86809-t33_1-p1.