CAZyme Information: ASPVEDRAFT_86574-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_86574-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		45074.10	3.8803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:1543374-1544855(-)

Full Sequence      

MQLPRALLLAVLGLTTSTSALVAFPGAEGFGANAVGGRGGDVYVVTNLEDSGEGSLRDAV
SATDRIVVFAVGGVINIEDRLVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIR
IRMGRGGDSGKDGITIAEGANMIFDHVSVSWGRDETFSISGTAENITVQNTIIAQGLETH
SCGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYLAGDSDGESFA
NIIGNYFISGPSTSVTAFSRGNANFHGYVENNFYDPDQYGSLSGSELGATSDSYGGMEIV
DTKYDYPAVASTLTPEEAVTYVTENVGASLVRDEVDTSLVDQVLSYGTDGALISDEDDFG
GVGDLDGGSAPTDTDGDGIPDDVEADLGTDPNVKDSTEIDSETGYSWLEVWANSLVPASY
AAQGNGTSTRR

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_86574-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	72	247	9.7e-55	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	1.88e-07	8	210	9	237	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.50e-04	79	221	28	190	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
408654	TSP3_bac	1.71e-04	373	392	1	20	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17310.1|PL1_2	8.48e-271	1	431	1	431
EAA62493.1|PL1_2	5.55e-239	4	422	3	417
CAP91803.1|PL1_2	2.78e-213	1	420	1	419
UDD60834.1|PL1_2	7.27e-211	8	421	7	419
QRD90936.1|PL1_2	2.95e-210	8	421	7	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	2.53e-06	28	223	46	251	VexL: A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B297|PLYC_EMENI	9.86e-240	4	422	3	417	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	3.00e-215	1	420	1	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	4.10e-215	8	420	7	418	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	4.25e-215	1	420	1	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	2.45e-214	1	420	1	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000454	0.999492	CS pos: 20-21. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_86574-t33_1-p1.