CAZyme Information: ASPVEDRAFT_85820-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_85820-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		41786.44	4.8100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:1438991-1440121(-)

Full Sequence      

MAGLVNSASRYGMAIFVFLLIFNMYLFNRVIRLNSQNETLEMSLQTSLPTLITSQPELAT
VTITNTVIATTTVAPETQAEPNKQDDTGYSAGIKPLLAHQASPEFPAKIWHKCGPKGVSE
PVQKYVDTWFTKNPNFRHELLTDESADQYVRENYAEWPEVLETYMALTVPILKADFLRVL
ILYADGGIWSDLDVTCEVPVSEWIPERFTKDTENPINVVVGLEFDGWQFASWTVMVKPHL
QHFKAVIEYVVRQLKYQANDNHVSVSELTKPMLTDVVAVTGPQAITMALLRSVSEETGQE
VTKDQIRHLKEPKLLGDILVLPQAAFAALQGGKPTDQGPYLVSHWYSGSWKNDAGGEEGQ
NQNPPKAAATTSASSS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_85820-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	206	3.8e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.97e-22	13	238	11	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.93e-18	119	206	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30122.1|GT32	9.63e-253	1	376	1	382
EAA62114.1|GT32	1.55e-188	1	372	1	379
QQK40626.1|GT32	2.35e-98	99	357	87	341
CAP80736.1|GT32	7.58e-97	101	357	89	341
CAK40793.1|GT32	2.11e-93	106	359	104	352

PDB Hits     

ASPVEDRAFT_85820-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	6.35e-27	104	352	129	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.03e-26	80	353	70	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	8.04e-26	104	353	141	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	3.94e-14	106	354	97	473	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000001

TMHMM  Annotations     

Start	End
7	26