CAZyme Information: ASPVEDRAFT_85617-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_85617-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43566.74	5.7179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:873381-874582(+)

Full Sequence      

MIYDSGSSKAGHIIVHIMRRRSILFCVFAIVLILLMYPFSSSYLLPTAELSPSEPLVPEP
EPEPQVPSSPNTSPYELLNRPISSDRTSIPKIIHQTWFPAGTNMSESAQQWVATVKTKNP
DWEYVLWDDESDELLVKKYFPWFLETYRQLPQEINRADMVRNFYMYLFGGMYLDVDTEAL
RPIDSLFVSHDVHLRPHKEVYAADHAPDSGTIQRAFMGRMAHTLDPEGLGAIPNGWMASP
PGHPYWLLPVLNVLENPKGDGSVEGMTGPGILGPIMKQYFGNGRQSLRRQLCHRVQTLQP
SWDLYCPHYSMEDIPASESLKHSLILLPREQIYPYSWVDDGDVKACLGAKSNPKFDPEEC
KRRMDVDAWPSYFITYCTHTW

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_85617-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	108	186	7e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.14e-26	82	280	75	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.13e-16	114	186	10	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29894.1|GT32	1.13e-270	1	381	1	380
EAA61879.1|GT32	7.41e-165	5	378	68	440
QMW48351.1|GT32	2.13e-140	19	381	12	362
QRD92713.1|GT32	4.27e-140	19	381	12	362
QMW36295.1|GT32	4.27e-140	19	381	12	362

PDB Hits     

ASPVEDRAFT_85617-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.09e-20	76	186	43	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	3.37e-18	89	279	62	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.12e-17	89	258	82	218	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.45e-15	89	279	55	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.86e-15	72	224	41	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000004

TMHMM  Annotations     

Start	End
23	45