CAZyme Information: ASPVEDRAFT_84923-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_84923-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737		80879.29	5.9670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878130:1191467-1193680(-)

Full Sequence      

MHKELVDFDDAVRLVQSGQTLEQATRALLAGMTQAERLSLLDGDEAFWKGLRGILFDRYN
RAPFVMGAIPRLKVPGIRFTDGPRGVVMHSSTCFPVSMSRGASWDVALEERIGDAIGLEG
RAQGANYFAGICINLPRHPAWGRIQETYGEDPILLGEFGLALHRGVRRYLMTCVKHYALN
SMENARFNVDVQVDDAALHEVYLPHFRQLVEAGVSSVMSSYNSVRGEFAGQNQELLNDIL
RKEWRFGGFVLSDFIFGLRDAVKSIKNGLDIEAPFQQQRALHVSEALARGDLAWSDIDRC
CMRILRAQLEHTVRTGRATPDCSVVFCDRHRELAREAAARGMVLLKNDPASDVPLLPLDP
AKVRTLAIVGRLSNRANTGDRGSSAVFAPNVVTFYEGLKAALPDATILLQDTDSVEEAQK
VAALADVVLCVVGYDAVDEGEYVVPSFADQKELLDLLPPALDREDAKVYDTIKGQKSTGF
GAGAEDSDALVPGAGGDRRSLRLRDRDVEIIRAVAAISSKVIVSVVAAGAVIMDDWLDSV
PALLFAWYSGGEGGHALADVLLGKVDASGRMPFSTPKAEEHLPYFDIAAEKITYDRWFGQ
RLLDKLGVAAQFPLGYGLSYTTFAMDGVAIDASPLDWGMDRFTVRTMVVNTGLRSGRHVV
QVYGTPQVPDFPSRVLLGFQSVELDSNEKKQVSVKCSTRPLKRRSRNRFLSVEQTIGVEI
ARYSGDKDCLKAIISLP

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_84923-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	273	1.7e-55	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.09e-62	71	702	101	731	beta-glucosidase BglX.
178629	PLN03080	1.90e-56	67	694	74	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.17e-37	342	620	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.86e-31	71	307	63	316	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	2.60e-04	658	701	1	46	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87369.1|GH3	1.02e-298	8	735	9	724
AGC95327.1|GH3	2.05e-298	8	732	9	721
BAE55411.1|GH3	1.66e-297	8	735	9	724
QKD58937.1|GH3	2.85e-297	8	736	26	751
UCK59088.1|GH3	3.34e-297	8	735	9	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.21e-67	69	693	32	624	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.31e-62	28	663	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.20e-61	28	663	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	3.49e-58	74	693	37	619	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.35e-53	28	694	9	792	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS8|BGH3A_BACO1	1.74e-71	59	692	63	700	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|P14002|BGLB_ACET2	1.14e-66	69	693	32	624	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	5.19e-62	28	663	5	734	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|F6C6C1|APY_BIFBA	4.49e-59	21	694	1	629	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
sp|E7CY69|APY_BIFLN	1.94e-57	21	694	1	629	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999174	0.000828

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_84923-t33_1-p1.