CAZyme Information: ASPVEDRAFT_83276-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_83276-t33_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		92779.51	7.9312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:2002218-2005121(+)

Full Sequence      

MTYPPHRSDESVELPGGGRASAGASPPYSAFVEDELTREAGSLQANGRVDINLESEVART
LAEIIDFQQEDLQSPPPGYIDTPSTQVRSCQFKLNIVIQIVGSRGDVQPFIALGTALKND
GHRIRIATHDVFADFVRGSGLEFFPIGGDPAQLMAFMVKNPGLIPQMRTLREGEVRKKQS
MVATMLDGCWRSCVDDDPLIQCPFVADAIIANPPSFAHIHCAQALGIPVHLMFTMPWSST
KAFPHPLANLSPSSMNPTTANWVSYGVVEVLTWQGLGDVINRWRVSIGLGPIPATQGPRL
AEALKIPFTYCWSPALMPKAEDWPSHIDVCGFFFREAQAYNPPAELEEFLNSGPSPIYIG
FGSIVADNPQRLIDTVLEAVSMAGVRAIISRGWSGMSGNTDRNICYIDDCPHEWLFQHVA
AVVHHGGAGTTACGLRNGRPTVVVPFFGDQPFWGHIIARSGAGPSPLPYASLTSQDLAAS
IEFCFTSKARAAAGNIAERMQTERGVTAAVESFYTHLPLDKMRCSVMPNQAAVWTFRKGK
RKFNLSKAAANILVENMKIEEKQLQCYETNPIFIENRRWDPLTGVLSASLATGSNMLLST
GQMIYNPYKEYRRTRSRRPSGEEGRVRSQSVPTTRASGNYSRSPEAGDLHIQTRRTDVSE
HSSNQTTRSLATAGNMTSATMKGFGKFTATYFKGVMVDIPHAAAEGFRQVPKLYGEQPRE
YGTVKDWKSGAMFGGRNFVDGMSDGFSGLLTHPVKGAKEQGVTGAAKGLMRGTIGLATKA
PSAGVGLVAYPMHGITKSIETAITSKDRRDLVYARLRDGSYYTEGMGITAQEQYRVIERF
EMLLRTENA

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	119	511	8.6e-55	0.9581151832460733

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.13e-79	94	513	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.11e-49	96	512	4	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	5.51e-21	96	244	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.28e-05	734	779	2348	2393	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	6.31e-05	105	481	7	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26658.1|GT1	0.0	1	849	1	845
CAP79869.1|GT1	0.0	16	848	10	845
CAK48301.1|GT1	0.0	24	843	20	840
BCS15859.1|GT1	0.0	24	843	20	840
BCS04269.1|GT1	0.0	24	843	20	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.55e-81	101	517	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	7.83e-81	101	517	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	7.89e-34	94	509	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	9.69e-33	94	509	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.14e-29	94	509	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	8.46e-120	93	518	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.71e-118	94	538	193	632	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.21e-78	24	517	917	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q5A950|ATG26_CANAL	1.11e-77	95	521	1016	1437	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|Q9Y751|ATG26_KOMPG	1.83e-76	50	521	730	1182	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_83276-t33_1-p1.