CAZyme Information: ASPVEDRAFT_82490-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_82490-t33_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	KV878127|CGC22	59289.01	4.6647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:3512559-3514231(-)

Full Sequence      

MLKAQVFGIALAILQSAKAWQIPAEYALTPSSNGRFLQQANGDPFFWQADTAWLLFHRLN
YSEADAFLSDRSEKGFNMVLAVAFTQAGIDNPNRNGDLPFIDEDVTDPNEPYWEHVDSVV
KLAWTKGIRICMVSSWGKFVHDSDNNGDVLNSTTAHPFGKFLGQRYPYLPKTLVGDTNPY
WQNKTAVKADYAYGGVLPPYEVTDWSPVYDDLANGIVAGERQAIKASSGHKSNTTWWPLM
TIHPTNQWFTGGPLALAHDFFGDREWLTLDASQSGHADYPPNPPIPWWNCRRGWEPVEIM
YAAGSKDGNKIRPVIDNEPHYENRYNNGKDTNAVWNASDVRVGSWQAVSTPLLPLGVPLI
AGIEICLLEQVFSGAAGLTYGANAIQQCIIPGLFDSDGSGPSDDWSTDLELPGSGQMQFI
QKAVLDRGNGTAYFHRVPAQDIIVGDAGVNDARVTATRDRGGNWIMVYTPTGEPFQIDTQ
SVKSCSVRASWYSPLSGRYTRFDYTQCGDSAGSAESRTFTPPAGDGHSDWALVLEVVN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_82490-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	31	348	1.4e-54	0.633495145631068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	3.18e-79	33	427	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.00e-27	437	535	1	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAE8332162.1|GH140	4.40e-309	1	538	2	511
KAE8313632.1|GH140	2.08e-307	1	538	2	511
KAB8203844.1|GH140	1.40e-305	1	538	2	511
KAB8225539.1|GH140	6.60e-304	1	538	2	511
KAB8252452.1|GH140	1.09e-302	1	538	2	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QFU_A	1.76e-44	15	498	18	430	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
5MSY_A	5.77e-43	28	498	18	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	6.15e-39	28	498	18	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPVEDRAFT_82490-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999750	CS pos: 19-20. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_82490-t33_1-p1.