CAZyme Information: ASPVEDRAFT_82092-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_82092-t33_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	KV878127|CGC22	37055.29	5.5713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:2547326-2548403(-)

Full Sequence      

MNKGLQTRSRGFFKQKPILRLVVALVALFSLIHLFSKYPHATLLDNTPRATVGKVMMVYG
NNSVYERAIETHKEHCNRLGYPLFILRREVLDGVWNKLAYLISLIVQELEKPEDERLEWL
YWIDSDTILMNPNMRLETFLPPPHLTNVHIVLSRDWNGMNAGVFPIRVDPWSIELLSAAI
GYPYTNPEETLTWAEQTAMVKLLAEHDYFAQSAVYVPLRWFNAYMRSPDGESLNTDSRAD
LQVHPGDLLVHFPGTPREDFNDTLSPYLAIAEQHRSEWELPLEKTGYAEETARFWKKYGI
ENGFELPDVQHVQEISNAGQV

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_82092-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	62	255	3.7e-32	0.8780487804878049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	2.48e-22	66	254	27	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	1.14e-06	91	178	178	264	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.56e-06	74	206	159	308	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22806.1|GT34	2.74e-220	1	321	65	385
BCS22997.1|GT34	3.96e-162	1	314	14	325
QKX62037.1|GT34	9.02e-120	35	297	283	549
QKX54237.1|GT34	3.72e-116	17	295	2	284
CAK96623.1|GT34	2.16e-95	57	295	1	227

PDB Hits     

ASPVEDRAFT_82092-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2X933|GT7_ORYSI	4.34e-09	54	219	121	299	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2
sp|Q6Z5M3|GT7_ORYSJ	4.34e-09	54	219	121	299	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1
sp|Q09681|GMH2_SCHPO	8.29e-08	59	264	113	337	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1
sp|O94622|YBKD_SCHPO	1.61e-07	48	254	97	332	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|O81007|GT7_ARATH	2.48e-07	67	216	147	313	Putative glycosyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=GT7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000014

TMHMM  Annotations     

Start	End
17	36