CAZyme Information: ASPVEDRAFT_81235-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_81235-t33_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		44804.51	4.2807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:282414-283774(-)

Full Sequence      

MVNIPLIVAAGSLFTLISGAPVSSSHSGAHRHTERHAHHAPSFAKRSYNVLGGSGKAADG
WPSHDNWWPEFEKMFEANRENMKQACDQWNVPNNSDQEMDDISSAIQEVASSSGVDPRFI
LAIVVQESNGCVRAPTTDNGVINPGLMQSHNGQGSCNKGGSVQTPCPKAQIKQMIEDGTA
GTSDGDGLKQCLAQAGGTDSSAYYAAARIYNSGSVDGSGNLGKGIATHCYSSDVANRLSG
WSSGPSSCEDNTIGSLDKAVTSLFRFAGGLLSGGSDSGSDSSSNDSTESQTSSTESTPEP
SPTQADPGVFAEEPTPTEAPSSTITSTATETSTSTSTSTYTLVDASSTPTPEPATTEPAA
NSAAPSSGSAPIYPNANSSCKEYYTVQDGDYCLKIEPETGVTVDQLRELNSGLEQDCTNL
WLGYQYCIKA

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_81235-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	4.04e-05	383	428	1	44	Lysin motif.
223021	PHA03247	0.003	245	370	362	469	large tegument protein UL36; Provisional
396179	LysM	0.006	384	423	1	37	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21809.1|CBM50|GH0	3.62e-239	1	430	1	439
EAA64687.1|CBM50|GH0	3.94e-170	1	430	1	441
QKX53872.1|CBM50|GH0	5.86e-127	4	430	4	400
CAP86012.1|CBM50|GH0	1.71e-103	6	430	6	417
QQK47925.1|CBM50|GH0	1.01e-95	6	430	6	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BUM_A	2.95e-06	380	428	2	48	Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AY86|LYSM6_ARTBC	2.40e-07	370	428	361	419	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999595	CS pos: 19-20. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_81235-t33_1-p1.