CAZyme Information: ASPVEDRAFT_81128-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_81128-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		69822.52	4.9581

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:4377299-4379305(-)

Full Sequence      

MPAWSVLALTAAPVVALIAGQTTLFSSPWETLFGSGSEEASMDGRIQARDLLSSHFGWYG
WPGQSYDYVIVGGGTAGLAMAHRLSEDGSHSVAVIEAGGFYEIEAGNATEVPMFLFNYFF
DNGHVKNPLLDWYQYTEPQPGLANREMFYMQGKTLGGSTARGAMLYHRGSKGAYKMWADQ
VGDDSYTWENWLPFFKKSVQFSGPSTNPRPANATTFNDISAFATNTSEEGPVQVAYPYLT
NAISSWVDKALERMGFPEAQGFSNGNLLGRSYITHTIHPKTRRRDTASTSYLQRALRTSN
NLNVITHTLVKRVLFDEEKRATGVIVNTGGFEWQIGARKEVILSAGVMRSPQLLMISGIG
PRETLEKLNIPVLSDLPGVGQNMQDTIILGPTNPVKVESHSQLMGSKETLPRSIFEYNNF
RTGLLTNPGQDYFAFEKHQPGSLSKGTSADIEKAFPADWPTFSYIALDDTFVPQYDGRNY
FSMSAALLATFSRGTVTINSTSTADNPVVDPRWLDDPRDKEMAVAAFRRCREVVASETMQ
EVIDGPELLPGFEYQTDEEILDYIAETSDAYYAGVGTCAMGKSSDPKAVLDSKARVRGVK
GLRVVDASAFPFAIDGQPMATVYALAEKIAAEILAGN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_81128-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	64	634	2.5e-173	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.59e-101	64	634	4	532	choline dehydrogenase; Validated
225186	BetA	2.01e-90	65	635	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.70e-42	491	629	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.18e-30	53	634	43	577	Protein HOTHEAD
366272	GMC_oxred_N	2.32e-25	144	385	16	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19620.1|AA3_2	0.0	1	637	1	639
QFQ50482.1|AA3_2	0.0	1	637	1	633
EAA61600.1|AA3_2	0.0	1	637	1	616
VBB75829.1|AA3_2	0.0	38	637	49	645
CDP25743.1|AA3_2	0.0	38	637	49	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	4.17e-62	65	630	5	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS2_AAA	1.03e-58	63	631	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	5.23e-58	63	631	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	5.23e-58	63	631	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	7.03e-58	63	631	21	574	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12062|AFLK_ASPPU	0.0	4	637	6	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|C8VDT4|STCN_EMENI	0.0	1	637	1	639	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|M2Y151|VBSA_DOTSN	0.0	37	637	47	647	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|A4UHS8|VBSA_DOTSE	0.0	37	637	47	647	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|A1CFL2|PATE_ASPCL	9.96e-154	16	633	10	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.052561	0.947393	CS pos: 20-21. Pr: 0.8765

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_81128-t33_1-p1.