CAZyme Information: ASPVEDRAFT_79432-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_79432-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		59986.28	6.7633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:117539-119225(+)

Full Sequence      

MATTNDFPASDVNAYDYVIVGGGTAGCVIASRLAQYLPNKRILLIEAGPSDYMDDRVLNL
KEWLNLLGGELDYDYPTVEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWESQ
GCTGWSFETFTRVLDGLRNTVQPVHDRHRNQLCKDWIQACSTAMNIPVIPDFNKEIRSKG
QLTEGVGFFSVSYNPDDGRRSSASVAYIHPILRGEEKRPNLTILTNAWVSRVNVNGDTVT
GVDITLQSGAKHTLQPKKETIICAGAVDTPKLLLHSGLGPKQQLASLGITVVKDIPGVGE
NLIDHPESIILWELNQPVPPNQTTMDSDAGIFLRREVPNAAGYDGRAADVMMHCYQIPFC
LNTSRLGYDTPVDAFCMTPNIPRPRSRGRLYLTSSDPNIKPALDFRYFTDPEGYDAATIV
TGLKAAREIAKQSPFKDWIKREVAPGPKVQSDEELSEYGRRVAHTVYHPAGTTKMGDVTR
DPMAVVDPKLRIRGLKNVRIADAGVFPEMPTVNPMLTVLAIGERAAELIAEEAGWKLEQP
RL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_79432-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	538	1.7e-91	0.517799352750809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.35e-121	15	534	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.12e-114	15	529	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.77e-46	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.70e-33	13	522	54	569	Protein HOTHEAD
366272	GMC_oxred_N	1.17e-27	15	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21375.1|AA3_2	0.0	1	542	1	542
EAA64559.1|AA3_2	0.0	1	542	1	542
BCS03844.1|AA3_2	0.0	1	542	90	631
BCS15458.1|AA3_2	0.0	1	542	1	542
CAK47101.1|AA3_2	0.0	1	542	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.57e-127	15	529	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.63e-127	15	529	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.02e-126	15	529	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	1.50e-58	15	533	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	4.01e-58	15	533	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.32e-126	15	529	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	4.33e-75	14	530	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.55e-71	15	532	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	9.42e-71	10	529	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q8NUM0|BETA_STAAW	3.81e-69	14	529	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_79432-t33_1-p1.