CAZyme Information: ASPVEDRAFT_77601-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_77601-t33_1-p1
• CAZy Family: GT109
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	KV878125|CGC8	92232.33	4.8420

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:167473-170052(-)

Full Sequence      

MLRLAYAIVLVSALVGGVYSEVIVYPEHYAQTKQSGRYNDNSTCLTLTPSNPIATLDYST
EIGGFPFFHAETSGTVQVESKYSEAKEGLDAPFGDGPWTFSNGLANTFRVETFNISEPGR
VESFFQQGGLRWQRLRLLSDRNVTICGVGIRSFNDRTDVTELPGYFECSNPLYNEIWKLG
ARTVQQACIEKGTAPTTWELTPDGVLLRGQQSAQSALGAEFANYTMSFRTKIVRGGTGWR
VASSPASFGPSFLLTSEYPENSTFLNTNRTLVPANTLAVGYGWNLVNQTSLPTGKVSYFP
LDFNVTEGQWIDISTRISPEGYIVTINDRHPVTVRLNDLQLVSNERFSSGSVYSGTWGFG
PWQDQIAYVKDVLVESHNGTLYENSMADDESVLEEYGVMDNPASVCLDGAKRDRLIWSGD
FAHTHRVVSASTYRPDFIRGTLSFLFERQEVSGPMAGLFAMSPAMGQSAKYTSVYKSYGL
LDYQMLLLNSFARYYLESADIQFVRKWWPKARAGLAALLPLVDKSSGLATSSLGAFFLGE
GNGTAASALFAYTLKDMANLADAVGEHNTSTHWKNTATNISRAVNNKLWNENIGTYSSSV
ASMNESSYIGTAWAILSDTANISQATSSIAALSSLRLGIGYKLSTDMADTDPETNLSPNL
SGFLLEALFSHARYNPDKATTDTIDFLLNGLWAAMVDQDEYYTGTSWEYVYPDGRPGLDL
FTSHAHPWGGAPTYIFSEYVLGVQPTKPGFEEWLFRPVIVDGLTWARGRVPTPRGRIEAE
WELDGMSLVLKVRAPGGTKGVVSIPLAARGCRITGDGHQDYCGGEGVRVVVGESASIDVS
LV

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	396	803	2.5e-66	0.7440476190476191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	4.80e-20	742	811	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	2.81e-06	493	740	109	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
395961	Trehalase	0.004	548	635	309	399	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
273702	oligosac_amyl	0.007	494	612	365	481	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19496.1|GH78	0.0	1	841	1	846
BCR89915.1|GH78	0.0	21	841	25	853
ANZ93894.1|GH78|3.2.1.40	0.0	12	842	52	886
BCS14345.1|GH78	0.0	41	842	62	865
CAK46278.1|GH78	0.0	21	842	29	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.19e-12	407	804	331	694	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	4.72e-06	408	741	237	543	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

ASPVEDRAFT_77601-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999762	CS pos: 20-21. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_77601-t33_1-p1.